DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and tbx-11

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_498317.1 Gene:tbx-11 / 185575 WormBaseID:WBGene00006547 Length:322 Species:Caenorhabditis elegans


Alignment Length:336 Identity:80/336 - (23%)
Similarity:129/336 - (38%) Gaps:92/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 PVQCHLE--TKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDS 338
            |:...|.  |..||...||...||:||.:|||:|||:..:.:|    :.....|::.:.:..:|.
 Worm     4 PISVTLSSTTDPLWRSCHEYDNEMVITVNGRRIFPTLEYTVTG----LDTFKLYSMCMHLDLVDD 64

  Fly   339 RRYRYAYHRSSW---LVAGKADPPPPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNEMDKSGQ- 399
            ::.|:.  ...|   :...|.|  ||.:::.|.......:.:.:. |||:::::||.:..:.|. 
 Worm    65 KKLRFT--GGQWAESVSTEKKD--PPRKVWHHNGSQTGKDWMLRN-VSFDQIRITNRKSKEDGNA 124

  Fly   400 --VVLNSMHRYQP---------RIHLVRLSHGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQN 453
              |.|.:.|||.|         .:|..|:.|.|                       |.:||||..
 Worm   125 SYVHLLTQHRYIPVLTIYEGDQLVHTARIPHSQ-----------------------FISVTAYHK 166

  Fly   454 QLITKLKIDSNPFAKGFRDSSRLSDFDRDPMDAFFFDQHMRTAPLRFFPDPLMSQLTPQEADAAS 518
            ..:..||.::||::.|.|...|                       |....|:.|:.|..|...:.
 Worm   167 GELNTLKTNNNPYSTGSRKDRR-----------------------RERQSPVYSEGTSSEKSISP 208

  Fly   519 MALLEKARQHLQMFGRSP-YTEMLLPHLYQ------------RSAAPPPPPPAPHLSAFQLGMWQ 570
                ..|::...|....| |:.:..|:|.|            .|.:||.||..|.....|:.|.|
 Worm   209 ----PPAKKIKDMAPALPDYSVISKPNLLQSLIFPMIAEQPSTSQSPPAPPVFPFNPDLQMQMLQ 269

  Fly   571 Q-QWPQLTAGF 580
            . ..||.  ||
 Worm   270 PFMLPQF--GF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 54/215 (25%)
tbx-11NP_498317.1 TBOX 4..189 CDD:238106 55/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.