DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and tbx-34

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_499441.1 Gene:tbx-34 / 176549 WormBaseID:WBGene00006553 Length:302 Species:Caenorhabditis elegans


Alignment Length:408 Identity:76/408 - (18%)
Similarity:126/408 - (30%) Gaps:165/408 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 KFHELG--TEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRYRYAYHRSSWL 351
            |:.||.  .||::.:.|.:|.|..:...||    :...:.|.:.|.:...|  .:||:|....| 
 Worm    10 KYRELEPLNEMLVKRGGVKMIPEPKFVISG----LVDNEEYVIKLRIDLAD--EFRYSYQNQQW- 67

  Fly   352 VAGKADPPPPSRIYAHPDCPLSPEALRK-------QVVSFEKVKLTNNEMDKSGQVV-LNSMHRY 408
                 .|..||...:........|..::       ::|.|:|:.:|....|....|: :...|:|
 Worm    68 -----TPFAPSTKNSKLSAITETEHRKETGATWNMRIVQFDKLLITREFNDIQRNVIHVEPNHKY 127

  Fly   409 QPRIHLVRLSHGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDS 473
            .|.:.:..::.|:|             ..|.|.:..|.||.:||                    |
 Worm   128 IPVLTIQNVTTGKS-------------TEFQFQQMEFIAVKSYQ--------------------S 159

  Fly   474 SRLSDFDRDPMDAFFFDQHMRTAPLRFFPDPLMSQLTPQEADAASMALLEKARQHLQMFGRSPYT 538
            :|:              :|.:.||.:.       .|.|                     |.|...
 Worm   160 ARI--------------RHTKRAPRKM-------NLAP---------------------GSSQKP 182

  Fly   539 EMLLPHL-----YQRSAAPPPPPPAPHLSAFQLGMWQQQWPQLTAGFLASANQQAALALAAAGAN 598
            ::::|.:     |..:|||||         |....| ..:||:....     ||.|.        
 Worm   183 QLIVPDILHSPTYGFTAAPPP---------FPFEYW-LLYPQIQYQI-----QQLAY-------- 224

  Fly   599 RTPPPSMAVAPPAPATPTSSCGSASPDLRA--------------RPQLNHY-------------- 635
                 |:.:.||........|..||..:.|              :.|.:||              
 Worm   225 -----SLPMGPPMVPIHHIQCTEASQRVYAPEYGWNSILMPGAHKEQDDHYMFHHEIWAPQDHEL 284

  Fly   636 -------PQRFSPYQVPQ 646
                   .|:..|.:.||
 Worm   285 EKLHVLTEQKNKPSETPQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 40/195 (21%)
tbx-34NP_499441.1 T-box 3..166 CDD:279278 42/214 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.