DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and mab-9

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_493750.1 Gene:mab-9 / 173441 WormBaseID:WBGene00003106 Length:346 Species:Caenorhabditis elegans


Alignment Length:321 Identity:140/321 - (43%)
Similarity:188/321 - (58%) Gaps:40/321 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PSQSPEELERLSPEESPAQQPTPKIVGSCNCDDLTPVQCHLETKELWDKFHELGTEMIITKSGRR 305
            ||:|||.           .:..||| |....:...|::|.||..|||.||.:|||||||||||||
 Worm    53 PSKSPER-----------SRGRPKI-GLKMKEGNLPIECKLEGSELWAKFFDLGTEMIITKSGRR 105

  Fly   306 MFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRYRYAYHRSSWLVAGKADPPPPSRIYAHPDC 370
            |||||:|||:..:...    .|.:.|||||:||:||||.|::|:||.||||:|.|.:|.|.|||.
 Worm   106 MFPTVKVSFTNVILDA----LYYIFLDVVPVDSKRYRYIYNKSAWLTAGKAEPVPKNRYYLHPDS 166

  Fly   371 PLSPEALRKQVVSFEKVKLTNNEMDKSGQVVLNSMHRYQPRIHLVRLSHGQSIPGSPKELQDMDH 435
            |.:.:.|.|.|:||||.||||||:||:|.::|||||:||||||:|:......:..:...:.:..|
 Worm   167 PFTGDQLLKHVISFEKTKLTNNEVDKTGHLILNSMHKYQPRIHIVQRQKANPLDPNKVVMSEEKH 231

  Fly   436 KTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLS--DFDRDPMDAFFFDQHMRTAPL 498
            .|:.||||.|.|||||||||||||||:.|||||||||.:..|  :.:|.|.|....:        
 Worm   232 CTYTFPETQFMAVTAYQNQLITKLKIEKNPFAKGFRDPTGRSPDEMERSPGDMMLSN-------- 288

  Fly   499 RFFPDPLMSQLTPQEADAASMALLEKARQHLQMFGRSPYTEMLLPHLYQRSAAPPPPPPAP 559
             |:....:.|...|:..:.::.|             :|...||..:::....:.|..|..|
 Worm   289 -FYHSSALQQAMFQQCLSKTLQL-------------NPSIMMLYQNVFPTGNSLPAAPTVP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 117/198 (59%)
mab-9NP_493750.1 TBOX 76..272 CDD:238106 117/199 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158642
Domainoid 1 1.000 249 1.000 Domainoid score I1163
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004466
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107249
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2836
SonicParanoid 1 1.000 - - X2653
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.