DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and tbx3b

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_002662050.2 Gene:tbx3b / 100334188 ZFINID:ZDB-GENE-060531-144 Length:594 Species:Danio rerio


Alignment Length:231 Identity:116/231 - (50%)
Similarity:147/231 - (63%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RLSPEESPAQQPTPKIVGSCNCDDLTPVQ-------CHLETKELWDKFHELGTEMIITKSGRRMF 307
            ||:.:||.|    |.::.....|   |||       .|||..|||.:||::||||:|||||||||
Zfish    45 RLALKESAA----PALLSGRTRD---PVQTPEDEPVVHLEGNELWGQFHKVGTEMVITKSGRRMF 102

  Fly   308 PTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRYRYAYHRSSWLVAGKADPPPPSRIYAHPDCPL 372
            |..:|..||..|:.    ||.:|:|:|..|.  |||.:|...|:|||||||..|.|:|.|||.|.
Zfish   103 PAFKVRCSGFDRKA----RYILLMDIVASDD--YRYKFHNCRWMVAGKADPEMPKRMYIHPDSPS 161

  Fly   373 SPEALRKQVVSFEKVKLTNNEMDKSGQVVLNSMHRYQPRIHLVRLSHGQSIPGSPKELQDMDHKT 437
            :.|....:.|:|.|:|||||..||.|..:|||||:||||.|:||.:....:|.|       ..||
Zfish   162 TGEQWMSKAVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDVLKLPYS-------TFKT 219

  Fly   438 FVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDS 473
            :|||||.|.|||||||:.||:||||:||||||||::
Zfish   220 YVFPETEFIAVTAYQNEKITQLKIDNNPFAKGFRET 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 109/205 (53%)
tbx3bXP_002662050.2 TBOX 74..256 CDD:238106 106/195 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.