DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and AT5G35830

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_198432.1 Gene:AT5G35830 / 833569 AraportID:AT5G35830 Length:282 Species:Arabidopsis thaliana


Alignment Length:275 Identity:66/275 - (24%)
Similarity:107/275 - (38%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   957 KSETPTGQSLFGDLGTESGMT----------PLHLAAFSGNENVVRLL-----LNSAGVQVDAAT 1006
            ||:.|..    ||:..|.|.|          |||        ||.|..     |.:.|||:..|.
plant    43 KSKEPPK----GDIIVEVGETCRSCPNKHHSPLH--------NVQRNFSCDDKLRAKGVQLYQAA 95

  Fly  1007 IENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLG--QGAE 1069
            ::           |...:..|:::.:...:.|.......|.||||....|...|..|||  :..:
plant    96 LK-----------GDWKAANGIIIEQKYIIYQKITSKSETVLHIAVAAKHEGFVRNLLGSLESND 149

  Fly  1070 INATDRNGWTPLHCAAKAGHLEVVKLLCEAGAS-PKSETNYGCAAIWFAASEGHNEVLRYLMNKE 1133
            :...:.:|.|.|..||.:|.:|:.|:|.|.... |..........|..||..||.|:::|     
plant   150 LALRNVDGNTALCFAAASGVVEIAKMLIEKNKDLPMIRGGGKTTPIHMAALFGHGEMVKY----- 209

  Fly  1134 HDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVA 1198
                 |.::.||        :..|:   :|||.:..|.:.....:.:|:...|...:||.|:...
plant   210 -----LYKNTRF--------REFND---EEFVNLFHAVISADIYVRSIHRCSSGDVRERGKEKST 258

  Fly  1199 AG----KQCEAMATE 1209
            :.    ||.:::|.:
plant   259 SPLDKYKQRDSLALD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560
ANK 654..780 CDD:238125
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786
Ank_2 697..790 CDD:289560
ANK 720..847 CDD:238125
ANK repeat 725..757 CDD:293786
ANK repeat 759..790 CDD:293786
Ank_5 779..834 CDD:290568
ANK 787..915 CDD:238125
ANK repeat 792..824 CDD:293786
ANK repeat 861..893 CDD:293786
Ank_4 865..915 CDD:290365
Ank_4 929..995 CDD:290365 14/52 (27%)
ANK repeat 932..972 CDD:293786 5/14 (36%)
ANK 969..1096 CDD:238125 36/143 (25%)
ANK repeat 974..1007 CDD:293786 13/47 (28%)
Ank_2 979..1074 CDD:289560 23/101 (23%)
ANK repeat 1009..1041 CDD:293786 3/31 (10%)
ANK 1039..1159 CDD:238125 32/122 (26%)
ANK repeat 1043..1074 CDD:293786 10/32 (31%)
Ank_2 1048..1135 CDD:289560 27/89 (30%)
ANK repeat 1076..1101 CDD:293786 10/24 (42%)
ANK repeat 1109..1134 CDD:293786 7/24 (29%)
Ion_trans <1393..1598 CDD:278921
AT5G35830NP_198432.1 ANK 91..210 CDD:238125 32/139 (23%)
Ank_2 91..183 CDD:289560 24/102 (24%)
ANK repeat 122..154 CDD:293786 10/31 (32%)
ANK repeat 156..188 CDD:293786 11/31 (35%)
Ank_4 157..210 CDD:290365 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.