DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and CG42391

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster


Alignment Length:160 Identity:34/160 - (21%)
Similarity:56/160 - (35%) Gaps:31/160 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 HMN-PTDIQKAMNRQSSVGWTPLLIACHRGHM------ELVNNLLANHARVDVFDTEGRSALHLA 700
            |.| .|:::..:|.:|:......||...|.|.      :.:|....|:..:|     .|...:|.
  Fly    41 HTNFSTELENTINSESNFKNISNLIKFVRQHSKWYRDNDCINRHYFNYILLD-----PRVTNNLK 100

  Fly   701 AERGYLHVCDALLT--NKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVID---ILTLRK 760
            .....||:.|...|  ...|...|.:..|..:||              |:...::|   .:||.|
  Fly   101 ERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHL--------------KNAQKLVDETNNITLVK 151

  Fly   761 QTPLHLAAASGQMEVCQLLLELGANIDATD 790
            ...|.|..:..:.....||:.....|.:.|
  Fly   152 DPKLALIVSIWKANRGVLLIRAFQGISSQD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560 19/87 (22%)
ANK 654..780 CDD:238125 28/136 (21%)
ANK repeat 660..690 CDD:293786 7/35 (20%)
ANK repeat 692..723 CDD:293786 7/32 (22%)
Ank_2 697..790 CDD:289560 20/97 (21%)
ANK 720..847 CDD:238125 15/74 (20%)
ANK repeat 725..757 CDD:293786 5/34 (15%)
ANK repeat 759..790 CDD:293786 6/30 (20%)
Ank_5 779..834 CDD:290568 3/12 (25%)
ANK 787..915 CDD:238125 1/4 (25%)
ANK repeat 792..824 CDD:293786
ANK repeat 861..893 CDD:293786
Ank_4 865..915 CDD:290365
Ank_4 929..995 CDD:290365
ANK repeat 932..972 CDD:293786
ANK 969..1096 CDD:238125
ANK repeat 974..1007 CDD:293786
Ank_2 979..1074 CDD:289560
ANK repeat 1009..1041 CDD:293786
ANK 1039..1159 CDD:238125
ANK repeat 1043..1074 CDD:293786
Ank_2 1048..1135 CDD:289560
ANK repeat 1076..1101 CDD:293786
ANK repeat 1109..1134 CDD:293786
Ion_trans <1393..1598 CDD:278921
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 14/64 (22%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 24/116 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.