DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and Ripk4

DIOPT Version :10

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_076152.2 Gene:Ripk4 / 72388 MGIID:1919638 Length:786 Species:Mus musculus


Alignment Length:801 Identity:189/801 - (23%)
Similarity:292/801 - (36%) Gaps:242/801 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 DRTPMHLAAENGHAHVIEILADKFKASIFERTK-DGSTLMHIASLNGHAECATMLFKKGVYLHMP 397
            |..|.::..: .|.||        |.|.|...| :|.:..|..|::|       ||  |...::|
Mouse   143 DLKPANILLD-AHYHV--------KISDFGLAKCNGMSHSHDLSMDG-------LF--GTIAYLP 189

  Fly   398 NKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYT-ALHI--AVESAKPAVVETLLGFGAD 459
            .:                   .:.:|....| |.:|.|: |:.|  .:...||        |..:
Mouse   190 PE-------------------RIREKSRLFD-TKHDVYSFAIVIWGVLTQKKP--------FADE 226

  Fly   460 VHVRGGKLRETPLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLL-- 522
            .::         |||..:|..|.|           |.|       |.....|....|:|:.|:  
Mouse   227 KNI---------LHIMMKVVKGHR-----------PEL-------PPICRPRPRACASLIGLMQR 264

  Fly   523 ----EDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKE-KHGPDKATTYINSVNE------ 576
                :.:..|.::..|.||          .|:.....|.||: .|.|.:.:: :.|.:|      
Mouse   265 CWHADPQVRPTFQEITSET----------EDLCEKPDEEVKDLAHEPGEKSS-LESKSEARPESS 318

  Fly   577 ----DGATALHYTCQITK-----------------------EEVKIPESDKQIVRMLLENGADVT 614
                ..|......|.:::                       .|.|:|.|... .|:...:..|..
Mouse   319 RLKRASAPPFDNDCSLSELLSQLDSGISQTLEGPEELSRSSSECKLPSSSSG-KRLSGVSSVDSA 382

  Fly   615 LQTKTALETAFHYCA-------------------VAGNNDVLMEMISHMNPTDIQKAMNRQSSVG 660
            ..::.:|..:|...|                   ::|:...||::   :.|.|:...::..:|: 
Mouse   383 FSSRGSLSLSFEREASTGDLGPTDIQKKKLVDAIISGDTSRLMKI---LQPQDVDLVLDSSASL- 443

  Fly   661 WTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFINSKSRV 725
               |.:|...|..|.|..||.|:|..::.:.:|.:.||:|.||....:.:.||..|..:|:|...
Mouse   444 ---LHLAVEAGQEECVKWLLLNNANPNLTNRKGSTPLHMAVERKGRGIVELLLARKTSVNAKDED 505

  Fly   726 GRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATD 790
            ..||||.||.||.....:.|: :.||.::.:....:||:|:|...||..:.:.||..|.::....
Mouse   506 QWTALHFAAQNGDEASTRLLL-EKNASVNEVDFEGRTPMHVACQHGQENIVRTLLRRGVDVGLQG 569

  Fly   791 DLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVI 855
            .....|:|.||...:..:.||..:|....|||.:.||.|..|:||.:|..:|...|:.......|
Mouse   570 KDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNI 634

  Fly   856 SARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNS 920
            .:   |...|||.:|||.||....:.|:..||........|:||:||||||||            
Mouse   635 CS---LQAQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQNGH------------ 684

  Fly   921 LRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFS 985
                                 ..||: ||....|.|.:..|..|            |.|||||..
Mouse   685 ---------------------LATVK-LLIEEKADVMARGPLNQ------------TALHLAAAR 715

  Fly   986 GNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHI 1050
            |:..||..|:                                     ||:|:...|..|.:.||:
Mouse   716 GHSEVVEELV-------------------------------------SADLIDLSDEQGLSALHL 743

  Fly  1051 AAMHGHIQMVEILLGQGAEIN 1071
            ||...|.|.||.||..||.||
Mouse   744 AAQGRHSQTVETLLKHGAHIN 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANKYR <125..371 CDD:440430 10/37 (27%)
ANK repeat 129..157 CDD:293786
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
ANK repeat 267..298 CDD:293786
ANKYR 281..572 CDD:440430 50/248 (20%)
ANK repeat 300..331 CDD:293786
ANK repeat 367..398 CDD:293786 7/30 (23%)
ANK repeat 400..431 CDD:293786 2/30 (7%)
ANK repeat 433..463 CDD:293786 7/32 (22%)
ANK repeat 469..499 CDD:293786 8/29 (28%)
ANK repeat 501..532 CDD:293786 6/36 (17%)
ANK repeat 534..575 CDD:293786 10/41 (24%)
ANK repeat 577..616 CDD:293786 8/61 (13%)
Ank_2 599..690 CDD:463710 20/109 (18%)
ANKYR 651..933 CDD:440430 84/281 (30%)
ANK repeat 660..690 CDD:293786 9/29 (31%)
ANK repeat 692..723 CDD:293786 10/30 (33%)
ANK repeat 725..757 CDD:293786 11/31 (35%)
ANK repeat 759..790 CDD:293786 9/30 (30%)
ANK repeat 792..824 CDD:293786 10/31 (32%)
ANKYR 843..1144 CDD:440430 62/229 (27%)
ANK repeat 861..893 CDD:293786 12/31 (39%)
ANK repeat 932..972 CDD:293786 8/39 (21%)
ANK repeat 974..1007 CDD:293786 10/32 (31%)
ANK repeat 1009..1041 CDD:293786 3/31 (10%)
TRPV 1035..1684 CDD:454755 17/37 (46%)
ANK repeat 1043..1074 CDD:293786 15/29 (52%)
ANK repeat 1076..1101 CDD:293786
ANK repeat 1109..1134 CDD:293786
Ripk4NP_076152.2 STKc_RIP4_like 25..290 CDD:270927 45/229 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..328 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..378 5/31 (16%)
ANKYR 432..709 CDD:440430 94/330 (28%)
ANK 1 439..468 10/32 (31%)
ANK repeat 442..470 CDD:293786 10/31 (32%)
ANK 2 472..501 9/28 (32%)
ANK repeat 473..503 CDD:293786 10/29 (34%)
ANK repeat 505..536 CDD:293786 11/31 (35%)
ANK 3 505..534 11/29 (38%)
ANK repeat 538..569 CDD:293786 9/30 (30%)
ANK 4 538..567 9/28 (32%)
ANK repeat 571..602 CDD:293786 9/30 (30%)
ANK 5 571..601 8/29 (28%)
ANK repeat 605..636 CDD:293786 10/30 (33%)
ANK 6 605..634 9/28 (32%)
ANK repeat 638..669 CDD:293786 11/30 (37%)
ANK 7 638..667 11/28 (39%)
ANK repeat 671..701 CDD:293786 17/63 (27%)
ANK 8 671..700 17/62 (27%)
Ank_2 676..766 CDD:463710 45/172 (26%)
ANK 9 704..734 14/78 (18%)
ANK repeat 736..766 CDD:293786 15/29 (52%)
ANK 10 736..765 15/29 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.