DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and ANKRD65

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_001138682.1 Gene:ANKRD65 / 441869 HGNCID:42950 Length:399 Species:Homo sapiens


Alignment Length:526 Identity:140/526 - (26%)
Similarity:201/526 - (38%) Gaps:169/526 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 KEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMN 654
            :.|.:..|.::|.:|. :|..::..|.|:|.                        .|:.:|    
Human     5 RPEPREEEEEEQELRW-MELDSEEALGTRTE------------------------GPSVVQ---- 40

  Fly   655 RQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFI 719
                 ||..||.|..||...||..||...|.|:..|..||:.||||..||:..:...||...|.:
Human    41 -----GWGHLLQAVWRGPAGLVTQLLRQGASVEERDHAGRTPLHLAVLRGHAPLVRLLLQRGAPV 100

  Fly   720 NSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGA 784
            .:..|.||||||.||.:|.:                                  .|.:|||:.||
Human   101 GAVDRAGRTALHEAAWHGHS----------------------------------RVAELLLQRGA 131

  Fly   785 NIDATDDLGQKPIHVAAQNNYSEVAKLFLQ---QHPSLVNATSKDGNTCAHIAAMQGSVKVIEEL 846
            :..|....|..|:|.||...::.:|...|:   ..|:...|....|.|.||.||..|.:.|: ||
Human   132 SAAARSGTGLTPLHWAAALGHTLLAARLLEAPGPGPAAAEAEDARGWTAAHWAAAGGRLAVL-EL 195

  Fly   847 MKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQV 911
            :....:|:..|         |.:||..|....::.|:..||.....:.||.||:.|||..|..|.
Human   196 LAAGGAGLDGA---------LLVAAAAGRGAALRFLLARGARVDARDGAGATALGLAAALGRSQD 251

  Fly   912 LDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGM 976
            ::||            ||    |                                    |.:.|:
Human   252 IEVL------------LG----H------------------------------------GADPGI 264

  Fly   977 TPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQD 1041
            ...|                             |.:.||.|...||:..|.||:::.|| :.::|
Human   265 RDRH-----------------------------GRSALHRAAARGHLLAVQLLVTQGAE-VDARD 299

  Fly  1042 RNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGW---TPLHCAAKAGHLEVVKLLCEAGASP 1103
            ..|.|.||.|:..||:::...||.:||:::||   ||   ||||.||:.||...|.||...||||
Human   300 TLGLTPLHHASREGHVEVAGCLLDRGAQVDAT---GWLRKTPLHLAAERGHGPTVGLLLSRGASP 361

  Fly  1104 KSETNY 1109
            ...|.:
Human   362 TLRTQW 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125 8/50 (16%)
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560 5/25 (20%)
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786 5/25 (20%)
Ank_2 625..722 CDD:289560 27/96 (28%)
ANK 654..780 CDD:238125 37/125 (30%)
ANK repeat 660..690 CDD:293786 13/29 (45%)
ANK repeat 692..723 CDD:293786 11/30 (37%)
Ank_2 697..790 CDD:289560 26/92 (28%)
ANK 720..847 CDD:238125 35/129 (27%)
ANK repeat 725..757 CDD:293786 9/31 (29%)
ANK repeat 759..790 CDD:293786 7/30 (23%)
Ank_5 779..834 CDD:290568 18/57 (32%)
ANK 787..915 CDD:238125 38/130 (29%)
ANK repeat 792..824 CDD:293786 9/34 (26%)
ANK repeat 861..893 CDD:293786 7/31 (23%)
Ank_4 865..915 CDD:290365 16/49 (33%)
Ank_4 929..995 CDD:290365 5/65 (8%)
ANK repeat 932..972 CDD:293786 1/39 (3%)
ANK 969..1096 CDD:238125 39/129 (30%)
ANK repeat 974..1007 CDD:293786 2/32 (6%)
Ank_2 979..1074 CDD:289560 25/94 (27%)
ANK repeat 1009..1041 CDD:293786 11/31 (35%)
ANK 1039..1159 CDD:238125 32/74 (43%)
ANK repeat 1043..1074 CDD:293786 12/30 (40%)
Ank_2 1048..1135 CDD:289560 29/65 (45%)
ANK repeat 1076..1101 CDD:293786 13/27 (48%)
ANK repeat 1109..1134 CDD:293786 0/1 (0%)
Ion_trans <1393..1598 CDD:278921
ANKRD65NP_001138682.1 ANK 1 40..69 14/37 (38%)
ANK <41..94 CDD:238125 22/52 (42%)
Ank_2 45..136 CDD:289560 39/124 (31%)
ANK repeat 45..71 CDD:293786 11/25 (44%)
ANK 69..192 CDD:238125 45/156 (29%)
ANK 2 73..102 11/28 (39%)
ANK repeat 74..104 CDD:293786 11/29 (38%)
ANK repeat 106..137 CDD:293786 16/64 (25%)
ANK 3 106..135 15/62 (24%)
ANK 4 139..168 7/28 (25%)
Ank_2 144..299 CDD:289560 54/246 (22%)
ANK 5 176..205 11/29 (38%)
ANK 6 207..231 7/23 (30%)
ANK 7 235..264 15/80 (19%)
ANK 252..355 CDD:238125 45/187 (24%)
ANK repeat 268..299 CDD:293786 12/60 (20%)
ANK 8 268..297 12/58 (21%)
Ank_2 273..364 CDD:289560 41/94 (44%)
ANK repeat 301..332 CDD:293786 13/33 (39%)
ANK 9 301..330 11/28 (39%)
ANK repeat 334..364 CDD:293786 15/29 (52%)
ANK 10 334..363 15/28 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.