DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and psmd10

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_991317.1 Gene:psmd10 / 403085 ZFINID:ZDB-GENE-050112-1 Length:226 Species:Danio rerio


Alignment Length:204 Identity:67/204 - (32%)
Similarity:109/204 - (53%) Gaps:12/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 LLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVC 776
            :|::.:......:..|||||.|...|..::.:||: |....:|:......||||:||::|:.|:.
Zfish    26 VLSDNSLAAKTDQDSRTALHWACSAGHVNIAQFLL-DLGVEVDLKDDACWTPLHIAASAGREEIV 89

  Fly   777 QLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVK 841
            :.|:..||.:::.:..|..|:|.||..|..|:|::.|:.... .|||.|..:|..|.|:.:|:.:
Zfish    90 RSLISKGAQLNSVNQNGCTPLHYAASKNLYEIAQILLENGAD-PNATDKLQSTPLHRASAKGNYR 153

  Fly   842 VIEELMKFDRSGVISARNKLTDA---TPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLA 903
            :|:.|:|      .||...:.|:   |||.||.:...|:..|.||..|||...|||...|.:.: 
Zfish   154 LIQLLLK------ESASTNIQDSEGNTPLHLACDEERAEAAKLLVEHGASIYIENKEKMTPLQV- 211

  Fly   904 AQNGHGQVL 912
            |:.|.|.||
Zfish   212 AKGGLGSVL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560 1/9 (11%)
ANK 654..780 CDD:238125 20/67 (30%)
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786 1/10 (10%)
Ank_2 697..790 CDD:289560 23/77 (30%)
ANK 720..847 CDD:238125 40/126 (32%)
ANK repeat 725..757 CDD:293786 11/31 (35%)
ANK repeat 759..790 CDD:293786 11/30 (37%)
Ank_5 779..834 CDD:290568 18/54 (33%)
ANK 787..915 CDD:238125 44/129 (34%)
ANK repeat 792..824 CDD:293786 11/31 (35%)
ANK repeat 861..893 CDD:293786 13/34 (38%)
Ank_4 865..915 CDD:290365 21/48 (44%)
Ank_4 929..995 CDD:290365
ANK repeat 932..972 CDD:293786
ANK 969..1096 CDD:238125
ANK repeat 974..1007 CDD:293786
Ank_2 979..1074 CDD:289560
ANK repeat 1009..1041 CDD:293786
ANK 1039..1159 CDD:238125
ANK repeat 1043..1074 CDD:293786
Ank_2 1048..1135 CDD:289560
ANK repeat 1076..1101 CDD:293786
ANK repeat 1109..1134 CDD:293786
Ion_trans <1393..1598 CDD:278921
psmd10NP_991317.1 Ank_4 13..60 CDD:290365 9/33 (27%)
ANK repeat 39..70 CDD:293786 11/31 (35%)
ANK 39..68 CDD:197603 10/29 (34%)
Ank_2 44..136 CDD:289560 30/93 (32%)
ANK 67..192 CDD:238125 42/131 (32%)
ANK repeat 72..103 CDD:293786 11/30 (37%)
ANK repeat 105..136 CDD:293786 11/31 (35%)
Ank_2 110..202 CDD:289560 33/98 (34%)
ANK repeat 138..169 CDD:293786 9/36 (25%)
ANK repeat 171..202 CDD:293786 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1759
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.