DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and Asb7

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_001102385.1 Gene:Asb7 / 365277 RGDID:1305154 Length:318 Species:Rattus norvegicus


Alignment Length:328 Identity:83/328 - (25%)
Similarity:130/328 - (39%) Gaps:92/328 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 LRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNA 822
            |:::..:..|.|:|.:...:.:||.|                     ||.             |.
  Rat    12 LQEELQIQAAVAAGDVHTVRKMLEQG---------------------YSP-------------NG 42

  Fly   823 TSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGA 887
            ...:|.|..|.:|.:|..:.:...:                        |.|....||.|:    
  Rat    43 RDANGWTLLHFSAARGKERCVRVFL------------------------EHGADPTVKDLI---- 79

  Fly   888 SCTEENKAGFTAVHLAAQNGHGQVLDVLKST--NSLRINSKKL-GLTPLHVAAYYGQADTVRELL 949
                   .||||:|.||.:|..::..::..:  .|..||:|.. |.|||||||:||:...||.||
  Rat    80 -------GGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLL 137

  Fly   950 TSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLL-NSAGVQVDAATIENGYNP 1013
                 ..|:|.        |..::.|.|||.||......:.||:|| :||.:.     |:||: .
  Rat   138 -----EFKAEV--------DPLSDKGTTPLQLAIIRERSSCVRILLDHSANID-----IQNGF-L 183

  Fly  1014 LHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGW 1078
            |..|....:.|...:.|.|.|:....:..:|:|.||::|:...:....:|...||:.|..:..|.
  Rat   184 LRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQ 248

  Fly  1079 TPL 1081
            |||
  Rat   249 TPL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560
ANK 654..780 CDD:238125 4/21 (19%)
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786
Ank_2 697..790 CDD:289560 7/31 (23%)
ANK 720..847 CDD:238125 15/88 (17%)
ANK repeat 725..757 CDD:293786
ANK repeat 759..790 CDD:293786 6/30 (20%)
Ank_5 779..834 CDD:290568 9/54 (17%)
ANK 787..915 CDD:238125 21/127 (17%)
ANK repeat 792..824 CDD:293786 3/31 (10%)
ANK repeat 861..893 CDD:293786 5/31 (16%)
Ank_4 865..915 CDD:290365 13/49 (27%)
Ank_4 929..995 CDD:290365 25/65 (38%)
ANK repeat 932..972 CDD:293786 15/39 (38%)
ANK 969..1096 CDD:238125 35/114 (31%)
ANK repeat 974..1007 CDD:293786 12/33 (36%)
Ank_2 979..1074 CDD:289560 27/95 (28%)
ANK repeat 1009..1041 CDD:293786 8/31 (26%)
ANK 1039..1159 CDD:238125 13/43 (30%)
ANK repeat 1043..1074 CDD:293786 9/30 (30%)
Ank_2 1048..1135 CDD:289560 11/34 (32%)
ANK repeat 1076..1101 CDD:293786 4/6 (67%)
ANK repeat 1109..1134 CDD:293786
Ion_trans <1393..1598 CDD:278921
Asb7NP_001102385.1 PHA02875 21..>241 CDD:165206 77/307 (25%)
ANK repeat 46..77 CDD:293786 8/54 (15%)
ANK repeat 81..114 CDD:293786 11/32 (34%)
ANK repeat 116..147 CDD:293786 17/43 (40%)
ANK repeat 149..180 CDD:293786 13/35 (37%)
ANK repeat 213..244 CDD:293786 9/30 (30%)
PTZ00322 219..>272 CDD:140343 10/33 (30%)
SOCS_ASB7 273..317 CDD:239696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.