DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and CG3104

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster


Alignment Length:349 Identity:101/349 - (28%)
Similarity:159/349 - (45%) Gaps:65/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   756 LTLRKQTP----LHLAAASGQMEVCQLLLELG-ANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQ 815
            ::|:|:||    ||:||..|.......:|:.| .::|..|:                        
  Fly     1 MSLKKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDE------------------------ 41

  Fly   816 HPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVK 880
                      ||.|...:||..|....:.||:  |:....::| :||..|||..||:|||.||||
  Fly    42 ----------DGTTPLILAAAGGHTYCVMELL--DQGADPNSR-RLTGTTPLFFAAQGGHLDVVK 93

  Fly   881 ALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINS-KKLGLTPLHVAAYYGQADT 944
            .|::||||....:..|.|.:.:|.|.||.:::..|....: .:|: .|...||:.::|..|.. |
  Fly    94 ILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGA-NVNAHMKDRATPVFISAQNGHR-T 156

  Fly   945 VRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIEN 1009
            |..||....|.:            |:....|.|||.:||..|.:::.::||.: |..||....: 
  Fly   157 VLSLLIQAGAEI------------DIKRIDGATPLWIAAQMGQDHICKVLLQN-GANVDTVRCD- 207

  Fly  1010 GYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATD 1074
            |..||..|...||.:|:.:||.....|  .|..||.:.||.|||.||:.:.:.|:..|:::...:
  Fly   208 GATPLFKAAHKGHAAVITVLLKYRPNL--GQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKN 270

  Fly  1075 RNGWTPLHCAAKAGHLEVVKLLCE 1098
            .:|.|.|..|    |.:....:|:
  Fly   271 HDGLTALQLA----HQQKYTSICD 290

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560
ANK 654..780 CDD:238125 9/27 (33%)
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786
Ank_2 697..790 CDD:289560 12/38 (32%)
ANK 720..847 CDD:238125 20/95 (21%)