DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and nas6

DIOPT Version :10

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_593722.1 Gene:nas6 / 2542919 PomBaseID:SPAC6C3.08 Length:234 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:77/240 - (32%)
Similarity:113/240 - (47%) Gaps:39/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   875 HADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLR-INSKKLGLTPLHVAAY 938
            :|.:.||:..   :|.||      .|..|.||          ..|||. ::..|  .||||.|..
pombe     3 YASLGKAIEE---NCPEE------YVEQAIQN----------DPNSLNAVDDDK--RTPLHWACS 46

  Fly   939 YGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGN--ENVVRLLLNSAGVQ 1001
            .|:.:|:..||..            .::..|...|:|.|||.::..:.:  :||:..|:|.:.|.
pombe    47 VGKVNTIYFLLKQ------------PNIKPDEKDEAGWTPLMISINNRSVPDNVIEELINRSDVD 99

  Fly  1002 VDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQ 1066
             ...|...|...||.|...|.:|:|.||..::.||::.:|..|:|.||.||..|.||:|:.|:.|
pombe   100 -PTITTRGGQTCLHYAAGKGRLSIVQLLCDKAPELIRKKDLQGQTPLHRAAAVGKIQVVKYLISQ 163

  Fly  1067 GAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASP--KSETNY 1109
            .|.:|.:|..|:||||.|...||.:|...|..|||..  |...|:
pombe   164 RAPLNTSDSYGFTPLHFALAEGHPDVGVELVRAGADTLRKDSENH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANKYR <125..371 CDD:440430
ANK repeat 129..157 CDD:293786
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
ANK repeat 267..298 CDD:293786
ANKYR 281..572 CDD:440430
ANK repeat 300..331 CDD:293786
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK repeat 501..532 CDD:293786
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 599..690 CDD:463710
ANKYR 651..933 CDD:440430 15/58 (26%)
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786
ANK repeat 725..757 CDD:293786
ANK repeat 759..790 CDD:293786
ANK repeat 792..824 CDD:293786
ANKYR 843..1144 CDD:440430 77/240 (32%)
ANK repeat 861..893 CDD:293786 5/17 (29%)
ANK repeat 932..972 CDD:293786 9/39 (23%)
ANK repeat 974..1007 CDD:293786 9/34 (26%)
ANK repeat 1009..1041 CDD:293786 11/31 (35%)
TRPV 1035..1684 CDD:454755 33/77 (43%)
ANK repeat 1043..1074 CDD:293786 14/30 (47%)
ANK repeat 1076..1101 CDD:293786 11/24 (46%)
ANK repeat 1109..1134 CDD:293786 0/1 (0%)
nas6NP_593722.1 ANKYR <19..211 CDD:440430 71/215 (33%)
ANK repeat 36..68 CDD:293786 11/45 (24%)
ANK repeat 71..104 CDD:293786 9/33 (27%)
ANK repeat 107..138 CDD:293786 11/30 (37%)
ANK repeat 140..171 CDD:293786 14/30 (47%)
ANK repeat 173..204 CDD:293786 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.