DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nompC and CG30271

DIOPT Version :9

Sequence 1:	NP_523483.2	Gene:	nompC / 33768	FlyBaseID:	FBgn0016920	Length:	1761	Species:	Drosophila melanogaster
Sequence 2:	NP_001188986.2	Gene:	CG30271 / 246518	FlyBaseID:	FBgn0050271	Length:	501	Species:	Drosophila melanogaster

Alignment Length:	129	Identity:	41/129 - (31%)
Similarity:	59/129 - (45%)	Gaps:	19/129 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   985 SGNENVVRLLLNSAGVQVDAAT--IENGYNPLHLACFGGHMSVVGLLLSR--SAELLQSQDRNGR 1045
            |.|..|.|.|         ||.  :.|....||.|....::..|...|..  .:.|:..:|.||.
  Fly    78 SNNGRVKRFL---------AAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVPSALVTCKDGNGL 133

  Fly  1046 TGLHIAAMHGHIQMVEILLG---QGAEINATDRNGWTPLHCAAKA-GHLEVVKLLCEAGASPKS 1105
            ..:|.||..||.:::|.|:|   :||  :.||..|.||||.||.| .::....||.:||...::
  Fly   134 NIIHKAAGLGHTKLLEYLVGIWPEGA--HETDITGKTPLHWAASAKNNMRCYTLLTQAGCDEEA 195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nompC	NP_523483.2	ANK repeat	129..157	CDD:293786
		Ank_2	131..228	CDD:289560
		ANK	155..319	CDD:238125
		ANK repeat	159..186	CDD:293786
		ANK repeat	232..265	CDD:293786
		Ank_2	237..331	CDD:289560
		ANK	263..387	CDD:238125
		ANK repeat	267..298	CDD:293786
		ANK repeat	300..331	CDD:293786
		Ank_2	305..398	CDD:289560
		ANK	329..454	CDD:238125
		ANK repeat	367..398	CDD:293786
		ANK repeat	400..431	CDD:293786
		Ank_2	405..498	CDD:289560
		ANK	428..555	CDD:238125
		ANK repeat	433..463	CDD:293786
		ANK repeat	469..499	CDD:293786
		ANK	496..641	CDD:238125
		ANK repeat	501..532	CDD:293786
		Ank_2	507..616	CDD:289560
		ANK repeat	534..575	CDD:293786
		ANK repeat	577..616	CDD:293786
		Ank_2	625..722	CDD:289560
		ANK	654..780	CDD:238125
		ANK repeat	660..690	CDD:293786
		ANK repeat	692..723	CDD:293786
		Ank_2	697..790	CDD:289560
		ANK	720..847	CDD:238125
		ANK repeat	725..757	CDD:293786
		ANK repeat	759..790	CDD:293786
		Ank_5	779..834	CDD:290568
		ANK	787..915	CDD:238125
		ANK repeat	792..824	CDD:293786
		ANK repeat	861..893	CDD:293786
		Ank_4	865..915	CDD:290365
		Ank_4	929..995	CDD:290365	4/9 (44%)
		ANK repeat	932..972	CDD:293786
		ANK	969..1096	CDD:238125	37/118 (31%)
		ANK repeat	974..1007	CDD:293786	7/23 (30%)
		Ank_2	979..1074	CDD:289560	27/95 (28%)
		ANK repeat	1009..1041	CDD:293786	7/33 (21%)
		ANK	1039..1159	CDD:238125	27/71 (38%)
		ANK repeat	1043..1074	CDD:293786	12/33 (36%)
		Ank_2	1048..1135	CDD:289560	24/62 (39%)
		ANK repeat	1076..1101	CDD:293786	11/25 (44%)
		ANK repeat	1109..1134	CDD:293786
		Ion_trans	<1393..1598	CDD:278921
CG30271	NP_001188986.2	ANK	100..206	CDD:238125	33/98 (34%)
		Ank_2	100..197	CDD:289560	33/98 (34%)
		ANK repeat	100..129	CDD:293786	6/28 (21%)
		ANK repeat	131..163	CDD:293786	12/33 (36%)
		ANK repeat	165..197	CDD:293786	12/31 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910