DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and F40G9.17

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_001379947.1 Gene:F40G9.17 / 13188172 WormBaseID:WBGene00185078 Length:240 Species:Caenorhabditis elegans


Alignment Length:214 Identity:57/214 - (26%)
Similarity:95/214 - (44%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 GRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLEL-GANIDAT 789
            ||:.:|.||:.|...|::|.|.:...:.........|||.:|:::|:::|.:.||.| ..::..|
 Worm    50 GRSTIHFAAVGGSLPLLQFAILNDPEMAHKTDDLGWTPLMIASSAGRVDVVRYLLTLPDVDVKHT 114

  Fly   790 DDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGV 854
            :...|..:|.|...|:.|:.||.::..|:::|...|.|.|..|.||.:|:               
 Worm   115 NSNKQTSLHYACSKNHVEIVKLLIEADPNIINLPDKFGATALHRAASRGN--------------- 164

  Fly   855 ISARNKLTDATPLQLAAEGGHADVVKALVRAG-ASCTEENKAGFTAVHLAAQNGHGQV--LDVLK 916
                    |.             :|:|||..| .|...::..|.||:|||.....|.|  |.|.:
 Worm   165 --------DV-------------IVRALVSTGKCSLDRQDGEGNTALHLACDENRGDVAILLVNR 208

  Fly   917 STNSLRINSKKLGLTPLHV 935
            ..:...:|.:|  .|||.:
 Worm   209 GADMKMLNKEK--QTPLEM 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560
ANK 654..780 CDD:238125 15/53 (28%)
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786
Ank_2 697..790 CDD:289560 18/64 (28%)
ANK 720..847 CDD:238125 35/121 (29%)
ANK repeat 725..757 CDD:293786 9/30 (30%)
ANK repeat 759..790 CDD:293786 9/31 (29%)
Ank_5 779..834 CDD:290568 17/55 (31%)
ANK 787..915 CDD:238125 33/130 (25%)
ANK repeat 792..824 CDD:293786 9/31 (29%)
ANK repeat 861..893 CDD:293786 7/32 (22%)
Ank_4 865..915 CDD:290365 15/52 (29%)
Ank_4 929..995 CDD:290365 3/7 (43%)
ANK repeat 932..972 CDD:293786 2/4 (50%)
ANK 969..1096 CDD:238125
ANK repeat 974..1007 CDD:293786
Ank_2 979..1074 CDD:289560
ANK repeat 1009..1041 CDD:293786
ANK 1039..1159 CDD:238125
ANK repeat 1043..1074 CDD:293786
Ank_2 1048..1135 CDD:289560
ANK repeat 1076..1101 CDD:293786
ANK repeat 1109..1134 CDD:293786
Ion_trans <1393..1598 CDD:278921
F40G9.17NP_001379947.1 ANK repeat 49..81 CDD:293786 9/30 (30%)
Ank_2 54..146 CDD:403870 25/91 (27%)
ANK repeat 84..115 CDD:293786 9/30 (30%)
ANK repeat 119..149 CDD:293786 9/29 (31%)
Ank_2 122..211 CDD:403870 32/124 (26%)
ANK repeat 151..183 CDD:293786 13/67 (19%)
ANK repeat 185..216 CDD:293786 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1759
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.