DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and ANKRD61

DIOPT Version :9

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_001258629.1 Gene:ANKRD61 / 100310846 HGNCID:22467 Length:418 Species:Homo sapiens


Alignment Length:314 Identity:87/314 - (27%)
Similarity:137/314 - (43%) Gaps:74/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 KDGNTCA-----HIAAMQGSVKVIEELMK---FDRSGVI---SARNK--LTDAT----PLQLAAE 872
            :||.:.|     :.|.|:.....||.|::   .::...|   ||.|:  ||..|    |:.|||:
Human    21 EDGPSAALHSKLYEAIMREDCTTIEVLLRNHPVNQPITILPNSASNRLLLTQPTESIIPIHLAAK 85

  Fly   873 GGHADVVKALVRAGASCTEENKAGFTAVHLA-----------AQNG---HGQVLDVLKST-NSLR 922
            ...|..:..|:|.||.....:..|.|.::|.           |:.|   |..:.|:..|: ..||
Human    86 YHKAQSLLCLLRHGADPEVRDTTGLTTLNLMLLHWPVTSTTWAKPGNRTHRILTDIQNSSITCLR 150

  Fly   923 --------------INSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTE 973
                          |::|:   :|||:|..|| ...|..:||...|.|.:.            .|
Human   151 ILCAHGAQVNTQGEISNKR---SPLHLAIAYG-CYPVLSILTQNGADVNAI------------NE 199

  Fly   974 SGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLA-C---------FGGHMSVVGL 1028
            :.|||||:||...|:.::..|: :.|..|:.|....|..||.|| |         .|..:|.:.|
Human   200 ASMTPLHMAANMLNKEMMETLI-AYGANVNCAVSSTGNTPLKLAVCTASSKAGRLLGAGVSCIRL 263

  Fly  1029 LLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082
            ||:..|: :.:||..|:|.:|.|...|...::.:||...|.:|...|||.:|::
Human   264 LLTHGAK-VNAQDYKGQTAIHEACFGGREAIINLLLEFEANVNILTRNGESPIY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560
ANK 654..780 CDD:238125
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786
Ank_2 697..790 CDD:289560
ANK 720..847 CDD:238125 7/26 (27%)
ANK repeat 725..757 CDD:293786
ANK repeat 759..790 CDD:293786
Ank_5 779..834 CDD:290568 3/13 (23%)
ANK 787..915 CDD:238125 31/120 (26%)
ANK repeat 792..824 CDD:293786
ANK repeat 861..893 CDD:293786 12/35 (34%)
Ank_4 865..915 CDD:290365 17/67 (25%)
Ank_4 929..995 CDD:290365 20/65 (31%)
ANK repeat 932..972 CDD:293786 11/39 (28%)
ANK 969..1096 CDD:238125 40/124 (32%)
ANK repeat 974..1007 CDD:293786 12/32 (38%)
Ank_2 979..1074 CDD:289560 32/104 (31%)
ANK repeat 1009..1041 CDD:293786 12/41 (29%)
ANK 1039..1159 CDD:238125 15/44 (34%)
ANK repeat 1043..1074 CDD:293786 9/30 (30%)
Ank_2 1048..1135 CDD:289560 11/35 (31%)
ANK repeat 1076..1101 CDD:293786 3/7 (43%)
ANK repeat 1109..1134 CDD:293786
Ion_trans <1393..1598 CDD:278921
ANKRD61NP_001258629.1 ANK 1 27..57 6/29 (21%)
ANK <32..115 CDD:295348 23/82 (28%)
ANK 2 75..104 9/28 (32%)
ANK 79..221 CDD:238125 41/157 (26%)
ANK repeat 79..106 CDD:293786 9/26 (35%)
Ank_2 80..198 CDD:289560 31/133 (23%)
ANK repeat 108..163 CDD:293786 10/54 (19%)
ANK 3 132..161 5/28 (18%)
ANK 166..298 CDD:238125 44/149 (30%)
ANK 4 167..196 12/32 (38%)
ANK repeat 169..198 CDD:293786 11/44 (25%)
Ank_2 172..275 CDD:289560 35/117 (30%)
ANK repeat 200..232 CDD:293786 12/32 (38%)
ANK 5 200..229 11/29 (38%)
ANK repeat 234..275 CDD:293786 12/41 (29%)
ANK 6 234..273 12/39 (31%)
Ank_5 263..317 CDD:290568 19/55 (35%)
ANK 272..>351 CDD:238125 15/45 (33%)
ANK repeat 277..308 CDD:293786 9/30 (30%)
ANK 7 277..306 8/28 (29%)
ANK 8 310..343 3/7 (43%)
ANK repeat 319..345 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.