DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12512 and AgaP_AGAP012093

DIOPT Version :9

Sequence 1:NP_608924.1 Gene:CG12512 / 33766 FlyBaseID:FBgn0031703 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_320434.4 Gene:AgaP_AGAP012093 / 1280581 VectorBaseID:AGAP012093 Length:129 Species:Anopheles gambiae


Alignment Length:121 Identity:26/121 - (21%)
Similarity:41/121 - (33%) Gaps:26/121 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 TSGTTGNPKAACLT---------HHNFVNNGIHVGNRNELEGERICVQVPMFHAFGVIISIMAAL 293
            |.||..|..|..|:         |......|...|:|..::.|.:       ||     .::..|
Mosquito    17 TLGTAANTLAPRLSAAGPFGWMKHRKSATQGFDDGDRPPVDPEAV-------HA-----DLLRRL 69

  Fly   294 TKGATMVLPAAGFSPKDSLQAIVNEKCSVIH---GTPTMYVDLVNTQKKLQVPLGR 346
            ||.....:......|......:..||.:| |   |..| ::.|....|:|...:.:
Mosquito    70 TKLYEQEVARELIVPPFKRALLYGEKAAV-HDQVGDFT-FIQLYEAVKRLAAQISK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12512NP_608924.1 PRK08315 43..592 CDD:236236 26/121 (21%)
FACL_like_2 229..577 CDD:213284 26/121 (21%)
AgaP_AGAP012093XP_320434.4 PRK03640 87..>123 CDD:235146 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.