DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12512 and abhd14a

DIOPT Version :9

Sequence 1:NP_608924.1 Gene:CG12512 / 33766 FlyBaseID:FBgn0031703 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_004914122.1 Gene:abhd14a / 100494859 XenbaseID:XB-GENE-1003239 Length:256 Species:Xenopus tropicalis


Alignment Length:174 Identity:38/174 - (21%)
Similarity:63/174 - (36%) Gaps:49/174 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GDVEAIVSCHEGKRYSFKSLLQEADALAA----GFRKLGLQ-PGDAVGLWA---------PNYLH 111
            |....:|....|:.::.|: .|:...|..    |:|.:.:. ||....|.|         .:||.
 Frog    77 GSERFVVLLLHGRSFTSKT-WQDLGTLGTLADHGYRAVAIDLPGYGESLRAQPMSSEKGRTDYLL 140

  Fly   112 WYLGMMGAARAGLTSVGLNPAYQGPEIAYCL-------NKVNVKAIIAP---ETFKTQNYYEILR 166
            ..:..:|..:..|..    |:..|   .:||       :::.....|||   ::||.:.|.:|. 
 Frog   141 HVMENLGTHQPVLVC----PSMSG---LFCLPLLMQHPDRLRGFVPIAPVGTKSFKQEQYQQIQ- 197

  Fly   167 DICPEI-----SDADTGKIRSEK---FPHLRSVIIDSNDSLKGA 202
              .|.:     .|.:.|....|.   .||.|.|      .|:||
 Frog   198 --VPTLIVYGTLDTNLGSQSLESLQLLPHHRLV------PLEGA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12512NP_608924.1 PRK08315 43..592 CDD:236236 38/174 (22%)
FACL_like_2 229..577 CDD:213284
abhd14aXP_004914122.1 MhpC 76..256 CDD:223669 38/174 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.