DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12512 and awat1

DIOPT Version :9

Sequence 1:NP_608924.1 Gene:CG12512 / 33766 FlyBaseID:FBgn0031703 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_012825452.1 Gene:awat1 / 100127622 XenbaseID:XB-GENE-5753328 Length:339 Species:Xenopus tropicalis


Alignment Length:189 Identity:43/189 - (22%)
Similarity:72/189 - (38%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSKLQTISRYMLRQKCAFNSMRSIS-TSMPSLISHKHHIGKDPLVYRTIGQQLELSASNFGDVEA 65
            |.|:.....|:|..     .|.|:: :|:..|:|| |..|...::  .:|          |..||
 Frog   149 NFKVPFYRDYLLAA-----GMCSVTHSSIDYLLSH-HGTGNAVVI--VVG----------GSAEA 195

  Fly    66 --------IVSCHEGKRYSFKSLLQEADAL---AAGFRKLGLQPGDAVGLWAPN----YLHWYLG 115
                    |::....|.:..|:|:..:..:   :.|..::..|...|||.|..:    :.|| :|
 Frog   196 LHCNRQSHILTLKNRKGFVKKALIHGSSLVPVYSFGENEVLHQCHFAVGSWKKSLQQMFQHW-VG 259

  Fly   116 -----MMGAARAGLTSVGLNPAYQGPEIAYCLNKVNVKAIIAPETFK-----TQNYYEI 164
                 ..|......||.|:.| ::.|     :|.|..|.|..|...|     .|.|:.:
 Frog   260 FAPCIFYGQGFFSSTSKGILP-FRKP-----INTVVGKPIPLPRVQKPSEEQIQKYHAL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12512NP_608924.1 PRK08315 43..592 CDD:236236 31/147 (21%)
FACL_like_2 229..577 CDD:213284
awat1XP_012825452.1 LPLAT 47..338 CDD:388412 43/189 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.