DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TotM and Victoria

DIOPT Version :9

Sequence 1:NP_001245887.1 Gene:TotM / 33764 FlyBaseID:FBgn0031701 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_788077.2 Gene:Victoria / 35275 FlyBaseID:FBgn0053117 Length:134 Species:Drosophila melanogaster


Alignment Length:113 Identity:43/113 - (38%)
Similarity:69/113 - (61%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRLFSVYGDSSVDEATKYRNIDSLVTFYDKYF 65
            ||..:.:|||:|....|||..:.::|.||..:.:.:..|:|:.|||:.||.||:.:|:.||:||.
  Fly    16 MNSALQISCLLVVLGCLLGSGHCQSEAEFAAKSREIAQVFGNPSVDKYTKARNLPTLIAFYEKYS 80

  Fly    66 TRLQLKPDLNTRAHDLLRRYKEENARVVLVDGTPAQGGFWLPLVKLLI 113
            :||:|.|......::.:|:||.:  |...|||..||||:...::|..|
  Fly    81 SRLRLTPQERISINNAMRQYKAQ--RNQQVDGVSAQGGWLSDIIKTAI 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TotMNP_001245887.1 Turandot 44..127 CDD:284622 29/70 (41%)
VictoriaNP_788077.2 Turandot 59..133 CDD:284622 29/70 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014269
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.