DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TotM and TotF

DIOPT Version :9

Sequence 1:NP_001245887.1 Gene:TotM / 33764 FlyBaseID:FBgn0031701 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_536780.3 Gene:TotF / 117461 FlyBaseID:FBgn0044811 Length:125 Species:Drosophila melanogaster


Alignment Length:123 Identity:48/123 - (39%)
Similarity:76/123 - (61%) Gaps:8/123 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMVFSVFLLGKVNAE---NEDEFVTEKQRLFSVYGDSSVDEATKYRNIDSLVTFYDKYFTRLQLK 71
            |..|.:.|||.:.||   ::.||..:.:::.:|:|:|.||..||.||:.:|:.||:||.:||.|.
  Fly     6 LFGFLLALLGYLEAEHAQSDPEFTAKARQMLAVFGNSEVDRYTKSRNLPALIEFYEKYSSRLPLT 70

  Fly    72 PDLNTRAHDLLRRYKEENARVVLVDGTPAQGGFWLPLVKLLIVQLGVEIASEGVKRAI 129
            ....|.|::::|||:..|.:  .|||.|||||  :.:|..|::...|.|. ||:.:||
  Fly    71 VQDRTYANNVIRRYRAHNNQ--QVDGVPAQGG--VGVVFALLLPFAVSIV-EGIAKAI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TotMNP_001245887.1 Turandot 44..127 CDD:284622 34/82 (41%)
TotFNP_536780.3 Turandot 43..122 CDD:284622 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014269
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.