DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TotM and TotX

DIOPT Version :10

Sequence 1:NP_523482.1 Gene:TotM / 33764 FlyBaseID:FBgn0031701 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_536781.2 Gene:TotX / 117460 FlyBaseID:FBgn0044810 Length:142 Species:Drosophila melanogaster


Alignment Length:98 Identity:29/98 - (29%)
Similarity:49/98 - (50%) Gaps:6/98 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSCLMVFSV-FLLGKVNAENEDEFVTEKQRLFSVYGDSSVDEATKYRNIDSLVTFYDKYFTRLQL 70
            |.|:.:..| |.....|:.:.:|   .:..|.:::.:..|:::.|.:||..|:.||.:|.|.:.|
  Fly     9 LICVFLGIVPFATANTNSSSYEE---HRNYLLNIFHNPFVNDSIKEKNIPQLIAFYQRYPTDVPL 70

  Fly    71 KPDLNTRAHDLLRRYKEENARVVLVDGTPAQGG 103
            ......:....:..|:|  .|.|||||.|.|||
  Fly    71 SDADRQQFERFIHDYRE--YRAVLVDGAPPQGG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TotMNP_523482.1 Turandot 44..127 CDD:399906 22/60 (37%)
TotXNP_536781.2 Turandot 45..125 CDD:399906 22/59 (37%)

Return to query results.
Submit another query.