DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and Acyp2

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_083620.1 Gene:Acyp2 / 75572 MGIID:1922822 Length:106 Species:Mus musculus


Alignment Length:94 Identity:44/94 - (46%)
Similarity:66/94 - (70%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEG 72
            ||.::|:||:|.|||:.....|.....|.|:.|||||:.:||:.|::|||:|:||.|.:|||..|
Mouse    13 LLKSVDYEVFGTVQGVCFRMYTEGEAKKRGLVGWVKNTSKGTVTGQVQGPEEKVDAMKSWLSKVG 77

  Fly    73 SPGCQIDRCEVRNQGNLSRLDYKDFAIRF 101
            ||..:|||.:..|:..:|:|:|.||:||:
Mouse    78 SPSSRIDRADFSNEKTISKLEYSDFSIRY 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 40/86 (47%)
Acyp2NP_083620.1 Acylphosphatase 13..105 CDD:279097 42/91 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7481
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41776
Inparanoid 1 1.050 101 1.000 Inparanoid score I4969
Isobase 1 0.950 - 0 Normalized mean entropy S5759
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm42435
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.