DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and CG34161

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001097143.1 Gene:CG34161 / 5740441 FlyBaseID:FBgn0085190 Length:125 Species:Drosophila melanogaster


Alignment Length:92 Identity:33/92 - (35%)
Similarity:53/92 - (57%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGS 73
            :.:..|||:|||||:...|.|:.:..:.|||||..|:.|||:.|.::|..:::..|..||..:||
  Fly    33 IFSCQFEVFGHVQGVFFRKHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQHKGS 97

  Fly    74 PGCQIDRCEVRNQGNLSRLDYKDFAIR 100
            |...|::........|...::|.|:||
  Fly    98 PRSVIEKAVFSENEPLPINNFKMFSIR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 31/86 (36%)
CG34161NP_001097143.1 Acylphosphatase 35..124 CDD:279097 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I457
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm42435
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - P PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
1110.880

Return to query results.
Submit another query.