DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and acyp1

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001116321.1 Gene:acyp1 / 571263 ZFINID:ZDB-GENE-050309-125 Length:99 Species:Danio rerio


Alignment Length:91 Identity:37/91 - (40%)
Similarity:60/91 - (65%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGS 73
            |:::|:||||.|||:...|.|:....:.|:.|||:|:..||:.|::|||..:|.:|..||.|.||
Zfish     7 LLSVDYEVYGRVQGVFFRKYTQTEGKRLGLVGWVQNTDAGTVQGQLQGPVSKVQQMQQWLQTTGS 71

  Fly    74 PGCQIDRCEVRNQGNLSRLDYKDFAI 99
            |..:|.:.|.:|:..:..|::|||.:
Zfish    72 PKSRIAKAEFQNEHPIHELEFKDFKV 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 36/86 (42%)
acyp1NP_001116321.1 Acylphosphatase 9..97 CDD:279097 36/87 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.