DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and acyp2

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001015794.1 Gene:acyp2 / 548511 XenbaseID:XB-GENE-944874 Length:103 Species:Xenopus tropicalis


Alignment Length:93 Identity:39/93 - (41%)
Similarity:63/93 - (67%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGS 73
            |.::|:||:|.|||:.....|.|...|.|:.|||||::|||:.|::|||:::|:.|..|||..||
 Frog    11 LKSVDYEVFGRVQGVCFRMYTEDEARKLGVVGWVKNTRQGTVTGQVQGPEDKVNSMKAWLSRVGS 75

  Fly    74 PGCQIDRCEVRNQGNLSRLDYKDFAIRF 101
            |..:|||.:..::..:::|.|..|:.|:
 Frog    76 PSSRIDRIDFNDEKEITKLQYNGFSTRY 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 37/86 (43%)
acyp2NP_001015794.1 Acylphosphatase 14..100 CDD:376373 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41776
Inparanoid 1 1.050 94 1.000 Inparanoid score I4926
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.