DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and CG11052

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster


Alignment Length:86 Identity:31/86 - (36%)
Similarity:47/86 - (54%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGSPGCQI 78
            |||:|.|||::....|..|..|.|:.||.||:.:.|:.|::|..:...:.|..||...|||..:|
  Fly    61 FEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKHTGSPTSRI 125

  Fly    79 DRCEVRNQGNLSRLDYKDFAI 99
            |:|.......||...:.:|:|
  Fly   126 DKCIFSETTELSEFTFTNFSI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 30/84 (36%)
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I457
Isobase 1 0.950 - 0 Normalized mean entropy S5759
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - P PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
1110.830

Return to query results.
Submit another query.