DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and Acyp2

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001162616.1 Gene:Acyp2 / 364224 RGDID:1595836 Length:124 Species:Rattus norvegicus


Alignment Length:93 Identity:41/93 - (44%)
Similarity:65/93 - (69%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGS 73
            |.::|:||:|.|||:.....|.....|.|:.|||||:.:||:.|::|||:|:|:.|.:|||..||
  Rat    32 LKSVDYEVFGTVQGVCFRMYTEGEAKKRGLVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGS 96

  Fly    74 PGCQIDRCEVRNQGNLSRLDYKDFAIRF 101
            |..:|||.:..|:..:|:|:|.:|:||:
  Rat    97 PSSRIDRADFSNEKTISKLEYSNFSIRY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 38/86 (44%)
Acyp2NP_001162616.1 Acylphosphatase 35..122 CDD:395576 38/86 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41776
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.