DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and Acyp

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster


Alignment Length:88 Identity:33/88 - (37%)
Similarity:49/88 - (55%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGSPGCQ 77
            :|||:|.|||:|..:....:....|:.||..||.:||:.|.::|...|:|.|..||.|.|||...
  Fly    10 EFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSS 74

  Fly    78 IDRCEVRNQGNLSRLDYKDFAIR 100
            |::.|..:|....|..|.:|.|:
  Fly    75 IEKVEFSSQRERDRYGYANFHIK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 32/85 (38%)
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I457
Isobase 1 0.950 - 0 Normalized mean entropy S5759
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - P PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
1110.830

Return to query results.
Submit another query.