DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14022 and CG10970

DIOPT Version :9

Sequence 1:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001285032.1 Gene:CG10970 / 31830 FlyBaseID:FBgn0030078 Length:103 Species:Drosophila melanogaster


Alignment Length:97 Identity:19/97 - (19%)
Similarity:37/97 - (38%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVTLDFEVYGHVQGLNLTKDTRD-----RCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWL 68
            ::..||||.|.|     .||..:     :....|:.|::....:....|:::|..:.:|.....:
  Fly     8 ILCCDFEVRGRV-----PKDAFELFALVQANALGLRGFIAQVSEEKFKGRLEGEGKVIDAFKKLI 67

  Fly    69 STEGSPGCQIDRCEVRNQGNLSRLDYKDFAIR 100
            .........|....::|...:....||.|.|:
  Fly    68 LAAADYVQAIKEFIIKNLKVIQEYTYKTFEIK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 18/91 (20%)
CG10970NP_001285032.1 Acylphosphatase 11..99 CDD:294372 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.