DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst12b.4

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_001338178.3 Gene:chst12b.4 / 797712 ZFINID:ZDB-GENE-090312-166 Length:340 Species:Danio rerio


Alignment Length:337 Identity:99/337 - (29%)
Similarity:149/337 - (44%) Gaps:79/337 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PPPPATTLNPVYEYSEELHSRTEREL------QRRSEHL-AAVCD-RYKLQEKYPPNPWEFFVSP 159
            ||.|.|.           |..:.:.|      |...:|| ..:|. ...|..:......:..:..
Zfish    32 PPYPRTN-----------HRASSKHLAQFKLRQAHRKHLIKELCSANSSLNYRQKSITLDHLIVD 85

  Fly   160 GHNNLVWCNVFKAASSTW---MYYF--NILAGYDVKYLQRTETQPLELARK-------------- 205
            .|:.:::|.|.|.|.|.|   |:..  |:.|.....||...:. |||:...              
Zfish    86 DHHRVIYCYVPKVACSNWKRVMFVLSQNLKAPDGAPYLDPLDI-PLEIIHNSTVHNTFKKLWMRH 149

  Fly   206 -RFPRPELGELM-ELLPSALSFLFVRDPFERILSAYRNKL-EGNKNTFYKALGNKIVHRYRKRNL 267
             |:.||    || :.|.:...||||||||.|::||||:|. |.|:..:|| .|..|:.||  .|:
Zfish   150 GRYARP----LMHQKLKNYTKFLFVRDPFVRLISAYRDKFAEPNEYYYYK-FGFMILQRY--ANI 207

  Fly   268 GGPWP-------RCG--PTFEEFVRFLI-AEHAAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETF 322
            ..| |       |.|  |:|..|::||: .:....|.|||||..::..|.||.:::..|||.||.
Zfish   208 SQP-PTLAPEAFRAGIRPSFSHFIKFLLDPQTEKEKPFDEHWKQIHRLCHPCQIDYDFIGKLETL 271

  Fly   323 QRDSEFIIRQAGLESLLLGLGK---LPQRKQRKIGNQARSGVKSEALVERYFADLDRSTLDQLLK 384
            ..|:|.:::       :|||.|   .|.      |.:.|:.|..|   :.:||::..:...:|..
Zfish   272 DEDTEHLLK-------ILGLDKHIHFPP------GYENRTAVDWE---QEWFANISLADRRELYS 320

  Fly   385 IYRIDFELFDYD 396
            :|..||:||.||
Zfish   321 LYETDFKLFGYD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 86/269 (32%)
chst12b.4XP_001338178.3 Sulfotransfer_2 85..331 CDD:308913 86/270 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.