DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst8

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_001336903.7 Gene:chst8 / 796549 ZFINID:ZDB-GENE-090410-1 Length:343 Species:Danio rerio


Alignment Length:394 Identity:103/394 - (26%)
Similarity:166/394 - (42%) Gaps:83/394 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NAYEHRERATAAELEAESEPSKQQLKLKRQQLQRQRILAKQQEQGKGIAGGNASAGSSSSQAAAP 101
            |:.:.:..||....|.:|:   |..|..|:.|:...||....         |.|:.||||.||. 
Zfish     5 NSPKKQLSATPGSREQDSQ---QVTKRHRKLLKTSAILRPHT---------NTSSSSSSSAAAV- 56

  Fly   102 PPPPPATTLNPVYEYSEELHSRTERELQRRSEHLAAVCDRYK---LQEKYPPNPWEFFVSPGHNN 163
                 |.:|     .||:...|.....:.|...:..||.:|:   .:...|.:....:|...| .
Zfish    57 -----AASL-----LSEKNTRRLSDVQEARKRIVREVCGKYRSNISRTITPHHVSRIYVEDRH-K 110

  Fly   164 LVWCNVFKAASSTWMYYFNILAG--------------YDVKYLQRTETQPLELARKRFPRPELGE 214
            |::|.|.||..|.|.....:|||              || .:|:|.::         |.|..:.:
Zfish   111 LLYCEVPKAGCSNWKRVLMVLAGVANSTQDINHVAVHYD-NHLKRLDS---------FDRQGITK 165

  Fly   215 LMELLPSALSFLFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKR------NLGGPWPR 273
            .:|   :....||||:|.||::||:|:|.|...:.::...|..|:.:||..      ..|.    
Zfish   166 RLE---TYTKVLFVREPMERLVSAFRDKFESPNSYYHPVFGKPIISKYRVNASQTALKTGS---- 223

  Fly   274 CGPTFEEFVRFLIAEH-AAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLES 337
             |.||.||:.:|:..| ..|  .|.||......|:||.:.:..|||.||.:.|:.|::|:.    
Zfish   224 -GVTFREFIHYLLDVHRPVG--MDIHWEATNQLCSPCHLRYDFIGKVETLEEDANFLLRKI---- 281

  Fly   338 LLLGLGKLPQR---KQRKIGNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDYDYRR 399
                  |.|:.   ...|.|| .::...|..:.:.||:.|:.|...:....|.:|:.:|:|. :.
Zfish   282 ------KAPESLTYPSFKDGN-PKAARTSTQITQHYFSQLNASERQRAYDFYYMDYLMFNYS-KP 338

  Fly   400 YYDM 403
            |.|:
Zfish   339 YKDL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 70/258 (27%)
chst8XP_001336903.7 Sulfotransfer_2 106..335 CDD:308913 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.