DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and Chst14

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001103109.1 Gene:Chst14 / 691394 RGDID:1585023 Length:375 Species:Rattus norvegicus


Alignment Length:352 Identity:101/352 - (28%)
Similarity:147/352 - (41%) Gaps:62/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LKLKRQQLQRQRILAKQQEQGKGIAGGNASAGSSSSQAAAPPPPPPATTLNPVYEYSEELHSRTE 125
            |.::|..|...:.|.......||.|.....            |.|...:.:     :|:...:..
  Rat    58 LMIERGILSEMKPLPLHPPSHKGAAWSGTD------------PKPRGLSFD-----AEDSDLQVR 105

  Fly   126 RELQRRSEHLAAVCDRYKLQEKYPPNPWEFFVSPGHNNL-----------VWCNVFKAASSTWMY 179
            .:::.|:  |.|||.    |...|.:||:..|......|           ::|.|.|.|.|.|..
  Rat   106 EDIRNRT--LRAVCG----QPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKR 164

  Fly   180 YFNILAG----YDVKYLQRTETQPLELARKRFPRPELGELMELLPSALSFLFVRDPFERILSAYR 240
            ...:|||    .||:......:..:.||..   |||  |:...|.....|||||||.||:|||||
  Rat   165 VLKVLAGVLNNVDVRLKMDHRSDLVFLADL---RPE--EIRYRLQHYFKFLFVRDPLERLLSAYR 224

  Fly   241 NKLEGNKNTFYKALGNKIVHRYRKRNLGGPWPRCGP--TFEEFVRFLIAEHAAGKRFDEHWAPVY 303
            ||. |....:.:..|.:||.|||..  .||.| .|.  ||.||:|:|:.|..  :..:|||.|||
  Rat   225 NKF-GEIREYQQRYGAEIVRRYRAG--AGPSP-AGDDVTFPEFLRYLVDEDP--EHMNEHWMPVY 283

  Fly   304 SFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKIGNQARSGVKSEALVE 368
            ..|.||:|::..:|..|..:.|:..::......|.:    :.|.|       ||.....|...:.
  Rat   284 HLCQPCAVHYDFVGSYERLEADANQVLEWVRAPSHV----RFPAR-------QAWYRPASPESLH 337

  Fly   369 RYFADLDRSTLDQLLKIYRIDFELFDY 395
            .:..:..|:.|..:|..|.:||.||.|
  Rat   338 YHLCNAPRALLQDVLPKYILDFSLFAY 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 80/251 (32%)
Chst14NP_001103109.1 Sulfotransfer_2 144..364 CDD:281554 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.