DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and CHST8

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001121367.1 Gene:CHST8 / 64377 HGNCID:15993 Length:424 Species:Homo sapiens


Alignment Length:386 Identity:102/386 - (26%)
Similarity:163/386 - (42%) Gaps:69/386 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EHRERAT---------AAELEAESEPS---KQQLKLKRQQLQRQRILAKQQEQGKGIAGGNASAG 92
            |..||.|         ...|.|..:|.   ::..:|:.:| :|:|:|.|:..     |.....|.
Human    70 EPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQ-RRRRLLIKKMP-----AAATIPAN 128

  Fly    93 SSSSQAAAPPPPPPATTLNPVYEYSEELHSRTERELQRRSEHLAAVCDRYKLQEK----YPPNPW 153
            ||.:....|.|    .||:..:   ..||    |..|.|...:...|.:|:....    .|.:..
Human   129 SSDAPFIRPGP----GTLDGRW---VSLH----RSQQERKRVMQEACAKYRASSSRRAVTPRHVS 182

  Fly   154 EFFVSPGHNNLVWCNVFKAASSTWMYYFNILAGY-----DVKYLQRTETQPLELARKRFPRPELG 213
            ..||...| .:::|.|.||..|.|.....:|||.     |:::    .|.....|.||....:..
Human   183 RIFVEDRH-RVLYCEVPKAGCSNWKRVLMVLAGLASSTADIQH----NTVHYGSALKRLDTFDRQ 242

  Fly   214 ELMELLPSALSFLFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKR------NLGGPWP 272
            .::..|.:....||||:||||::||:|:|.|...:.::...|..|:.|||..      ..|.   
Human   243 GILHRLSTYTKMLFVREPFERLVSAFRDKFEHPNSYYHPVFGKAILARYRANASREALRTGS--- 304

  Fly   273 RCGPTFEEFVRFLIAEH-AAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLE 336
              |..|.|||::|:..| ..|  .|.||..|...|:||.:::..:||.|:.:.|:.|.:      
Human   305 --GVRFPEFVQYLLDVHRPVG--MDIHWDHVSRLCSPCLIDYDFVGKFESMEDDANFFL------ 359

  Fly   337 SLLLGLGKL--PQRKQRKIGNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDY 395
            ||:.....|  |:.|.|. ..:||:..:   :..:|||.|......:....|.:|:.:|:|
Human   360 SLIRAPRNLTFPRFKDRH-SQEARTTAR---IAHQYFAQLSALQRQRTYDFYYMDYLMFNY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 70/248 (28%)
CHST8NP_001121367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..107 8/36 (22%)
Sulfotransfer_2 187..416 CDD:308913 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.