DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and Chst12

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_067503.3 Gene:Chst12 / 59031 MGIID:1929064 Length:419 Species:Mus musculus


Alignment Length:359 Identity:87/359 - (24%)
Similarity:140/359 - (38%) Gaps:87/359 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SSSQAAAPPPPPPATTLNPVYEYSEE-----------LHSRTERELQR--RSEHLAAVCDRYKLQ 145
            |..:...||.|.|:   .||..:.||           .|...:|:.|:  |...|...|....| 
Mouse    82 SRRKTEQPPVPAPS---KPVLSHMEENVRGYDWSTHDAHQNPDRDRQQAERRSLLRDFCANASL- 142

  Fly   146 EKYPPNPWEFFVSPGH----------NNLVWCNVFKAASSTWMYYFNILAGYDVKYLQRTE--TQ 198
             .:|.....|...|.:          :.:::|.|.|.|.:.|.....:|:   ...|.|..  ..
Mouse   143 -AFPTKDRSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLS---ESLLDRGSPYRD 203

  Fly   199 PLELARK-------------------RFPRPELGELMEL-LPSALSFLFVRDPFERILSAYRNKL 243
            ||::.|:                   :|.|    .||:: |.....||||||||.|::||:|:|.
Mouse   204 PLDIPREHVHNTSTHLTFNKFWRRYGKFSR----HLMKVKLKKYTKFLFVRDPFVRLISAFRSKF 264

  Fly   244 EGNKNTFYKALGNKIVHRYRKR-----------NLGGPWPRCGPTFEEFVRFLIAEHAAG-KRFD 296
            |.....||:.....::..|...           :.|     ...:|..|:::|:..|... ..|:
Mouse   265 ELENEEFYRKFAVPMLRLYANHTSLPASVSEAFSAG-----LKVSFANFIQYLLDPHTEKLAPFN 324

  Fly   297 EHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKIGNQARSGV 361
            |||..||..|.||.:::..:||.||...|:..::|...::|.|    ..|...:.:         
Mouse   325 EHWRQVYRLCHPCQIDYDFVGKLETLDEDAAQLLRFLKVDSQL----HFPPSYRNR--------- 376

  Fly   362 KSEALVERYFADLDRSTLDQLLKIYRIDFELFDY 395
            .:.:..|.:||::..:...||.|:|..||.||.|
Mouse   377 TASSWEEDWFANIPLAWRQQLYKLYEADFVLFGY 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 67/278 (24%)
Chst12NP_067503.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..99 6/19 (32%)
Sulfotransfer_2 165..410 CDD:367564 67/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.