DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and Chst11

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_067414.2 Gene:Chst11 / 58250 MGIID:1927166 Length:352 Species:Mus musculus


Alignment Length:307 Identity:93/307 - (30%)
Similarity:146/307 - (47%) Gaps:43/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 EELHSRTEREL-------QRRSEHLAAVCDRYKLQEK----YPPNPWEFFVSPGHNNLVWCNVFK 171
            :||::..:.||       |.|.:.:...|.......:    ..||..:..|....:.|::|.|.|
Mouse    61 QELYNPIQLELSNTAILHQMRRDQVTDTCRANSAMSRKRRVLTPNDLKHLVVDEDHELIYCYVPK 125

  Fly   172 AASSTWMYYFNILAGYDVKYLQRTETQPLELAR---------KRFPRPELGELMELLPSALSFLF 227
            .|.:.|.....:|:|.. ||     :.|:|:..         |...:..:.|:...|.|.:.|||
Mouse   126 VACTNWKRLMMVLSGRG-KY-----SDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLF 184

  Fly   228 VRDPFERILSAYRNKLEGNKNT-FYKALGNKIVHRYRKRNLGGPWPRCGP--TFEEFVRFLIAEH 289
            ||:||||::||||||.....|| |:|..|.||:.|.|| |......|.|.  .|||||.:||..|
Mouse   185 VREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIRRQRK-NATQEALRKGDDVKFEEFVAYLIDPH 248

  Fly   290 AAGKR-FDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKI 353
            ...:. |:|||..|||.|.||.:::.::||.||.:.||.::::.||:...|            |.
Mouse   249 TQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVSGYL------------KF 301

  Fly   354 GNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDYDYRRY 400
            ...|:|...::.:...:|.::......||.::|::||.:|:|....|
Mouse   302 PTYAKSTRTTDEMTTEFFQNISAEHQTQLYEVYKLDFLMFNYSVPNY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 81/247 (33%)
Chst11NP_067414.2 Sulfotransfer_2 113..343 CDD:281554 81/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.946395 Normalized mean entropy S6946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.