DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst12

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001015949.1 Gene:chst12 / 548703 XenbaseID:XB-GENE-1014616 Length:420 Species:Xenopus tropicalis


Alignment Length:345 Identity:89/345 - (25%)
Similarity:154/345 - (44%) Gaps:63/345 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SSQAAAPPPPPPATTLNPV--YEYS--EELHSR-TEREL--QRRSEHLAAVCDR----YKLQEK- 147
            |::|...|...|::....|  |::|  |:|... .::|:  |.|..:|...|..    :..:|: 
 Frog    86 STKAEKMPLRGPSSLEENVRGYDWSTKEKLEDAILDQEIIQQERKRNLLQFCGNSSFSFPTKERS 150

  Fly   148 ---YPPNPWEFFVSPGHNNLVWCNVFKAASSTWMYYFNILAG--YDVKYLQRTETQPLELARK-- 205
               .|....:..:....:.:::|.|.|.|.:.|.....:|:.  .|.|.:...:  ||.:.|:  
 Frog   151 FDDIPNRELDHLIVDDRHGIIYCYVPKVACTNWKRVMIVLSESLLDKKGVPYQD--PLLIPREDV 213

  Fly   206 -----------------RFPRPELGELMEL-LPSALSFLFVRDPFERILSAYRNKLEGNKNTFYK 252
                             :|.|    .:|:: |.....||||||||.|::||:|:|.|.....||:
 Frog   214 HNTSSHLTFNKFWRRYGKFSR----HMMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENEDFYR 274

  Fly   253 ALGNKIVHRYRKR-----NLGGPWPR-CGPTFEEFVRFLIAEHAAGKR-FDEHWAPVYSFCTPCS 310
            :....|:.|:..|     .:|..:.. ..|:|.:|:::|:......:| |:|||..||..|.||.
 Frog   275 SFAVPILTRFSNRTSVPDTVGEAFSSGAMPSFSQFMQYLLDPQTEEQRPFNEHWRQVYRLCHPCQ 339

  Fly   311 VNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKIGNQARSGVKSEALVERYFADLD 375
            :.:..|||.||...|:..::||..||||.    :.|...:    |:..|..:.:     :::.|.
 Frog   340 IEYDFIGKLETLSEDAALLLRQLNLESLF----QFPPSYR----NRTASSWEDD-----WYSKLP 391

  Fly   376 RSTLDQLLKIYRIDFELFDY 395
            .:...:|.|:|..||.||.|
 Frog   392 VAWRKKLYKLYEADFVLFGY 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 72/263 (27%)
chst12NP_001015949.1 Sulfotransfer_2 165..411 CDD:367564 72/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.