DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and Chst13

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001178903.1 Gene:Chst13 / 500257 RGDID:1562825 Length:340 Species:Rattus norvegicus


Alignment Length:356 Identity:95/356 - (26%)
Similarity:139/356 - (39%) Gaps:78/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ASAGSSSSQAAAPPPPPPATTLNPVYE--------YSEELHSRTE--REL------------QRR 131
            ||.|::.....|.|     ..|.|.:|        :..|..|..:  |||            |:|
  Rat    15 ASLGAALLFLCAAP-----RALRPAFENKVLGSGWFGGERKSPLQLLRELDQGPRSAMAEVHQQR 74

  Fly   132 SEHLAAVCDRY-KLQEKYPPNPWEFFVSPGHNNLVWCNVFKAASSTWMYYFNILAGYDVKYLQRT 195
            .|.|...|.|: :.|....|......:....:.|::|.|.|.|.:.|......|.|         
  Rat    75 RELLRRACSRHTRRQRLLQPEDLRHVLVDDKHRLLYCYVPKVACTNWKRVLLALRG--------- 130

  Fly   196 ETQPLELARKRFPRPEL---------GELMELLPSALSFLFVRDPFERILSAYRNKL-EGNKNTF 250
            ...|..:.......|.|         .|:...|...|:|||||:||||:.||||||| ..:...|
  Rat   131 RGDPGAIPAHEAHEPGLLPSLADFAPAEVNRRLRDYLTFLFVREPFERLASAYRNKLARPHSAAF 195

  Fly   251 YKALGNKIVHRYRKRNLGGPWPRCGP---------TFEEFVRFLIAEHAAG-KRFDEHWAPVYSF 305
            .:..|.:||.|.|        |...|         .|.||:.:|:...... :.|:|||...::.
  Rat   196 QRRYGTRIVRRLR--------PHAQPDALARGHDVRFAEFLAYLLDPRTRRYEPFNEHWERAHAL 252

  Fly   306 CTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKL-PQRKQRKIGNQARSGVKSEALVER 369
            |.||.|.:.::||.||...|:.|::...|...|......| |::...::  |||          |
  Rat   253 CHPCLVRYDVVGKFETLADDAAFVLHLVGEPGLRFPAPPLRPEKDLTRV--QAR----------R 305

  Fly   370 YFADLDRSTLDQLLKIYRIDFELFDYDYRRY 400
            .|.|:......:|..:|::||.||:|....|
  Rat   306 LFQDISPFYQRRLFDLYKMDFLLFNYSAPSY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 72/255 (28%)
Chst13NP_001178903.1 Sulfotransfer_2 103..331 CDD:281554 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.