DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst10

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_005159945.1 Gene:chst10 / 445322 ZFINID:ZDB-GENE-040808-40 Length:399 Species:Danio rerio


Alignment Length:302 Identity:79/302 - (26%)
Similarity:129/302 - (42%) Gaps:66/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 QRRSEHLAAVCDRYKLQEKYPPNPW-------------EFFVSPGHNNLVWCNVFKAASSTWMYY 180
            ::|.|.|:.||....:        |             ..||...| .:::|...|..::.|...
Zfish   121 EKRLEQLSTVCSNSSI--------WNLTHTTVRKFVLDRIFVCDKH-KILFCQTPKVGNTQWKKV 176

  Fly   181 FNILAGYDVKYLQRTETQPLELA--RKRFPRPELG-----ELMELLPSALSFLFVRDPFERILSA 238
            ..:|.|   |: .:.|..|..|.  .:|...|.|.     |:.:.|.|...|..|||||||::||
Zfish   177 LIVLNG---KF-SKVEAIPENLVHDHERNGLPRLSSMTDTEIHQRLNSYFKFFIVRDPFERLISA 237

  Fly   239 YRNKLEGNK--NTFYK-ALGNKIVHRYRKRNLGGPWPRCGPTFEEFVRFL---IAEHAAGKRFDE 297
            :::|...|.  ..:|| .:...||.:|| |:........|..||:|||:|   .......::|.:
Zfish   238 FKDKFVKNPRFEPWYKHDIAPAIVRKYR-RSHHDDSESVGLRFEDFVRYLGDKTGRQHLDRQFGD 301

  Fly   298 ---HWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLL------GLGKLPQRKQRKI 353
               ||......|.||.:::.::|..||.:.|:.:|::.||:..|:.      |:.:..:.|    
Zfish   302 HIIHWLTYAELCAPCDISYNVVGHHETLELDAPYILKSAGIAGLVSYPSIPPGITRYNRTK---- 362

  Fly   354 GNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDY 395
                         |||||:.:.:..:.:|...|:.||.||||
Zfish   363 -------------VERYFSGISQRDIRRLYARYQGDFSLFDY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 69/256 (27%)
chst10XP_005159945.1 Sulfotransfer_2 155..391 CDD:281554 69/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.