DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst12a

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_998712.2 Gene:chst12a / 407076 ZFINID:ZDB-GENE-081022-13 Length:436 Species:Danio rerio


Alignment Length:346 Identity:85/346 - (24%)
Similarity:146/346 - (42%) Gaps:76/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PPPATTLNPVYEYSEE--------------LHSRTERELQRRSEHLAAVC---------DRYKLQ 145
            |||....|...|.|:|              :....:::.:.|.:.:..||         .:.:..
Zfish   104 PPPGDPHNQSSEKSDEKFVPRREWKIHLSPIDPEKKQKQENRKQLIQDVCGNKSVFDFPGKNRTF 168

  Fly   146 EKYPPNPWEFFVSPGHNNLVWCNVFKAASSTWMYYFNILAGY----DVKYLQRTETQPLELARK- 205
            :..|....:..:....:.:::|.|.|.|.:.|.....:|:..    .|.|....:. |.||... 
Zfish   169 DDIPNKELDHLIVDDRHGIIYCYVPKVACTNWKRIMIVLSESLLVDGVPYQDPLDV-PQELIHNS 232

  Fly   206 --------------RFPRPELGELMEL-LPSALSFLFVRDPFERILSAYRNKLEGNKNTFYKALG 255
                          :|.|    .||:: |.....||||||||.|::||||||.|.....|||...
Zfish   233 SLHFTFNKFWKRYGKFSR----HLMKIKLKKYTKFLFVRDPFVRLISAYRNKFEQENEDFYKRFA 293

  Fly   256 NKIVHRYRKRNLGGPWPR---------CGPTFEEFVRFLIAEHAAGKR--FDEHWAPVYSFCTPC 309
            ..::.:|  .|...| |.         ..|:|..||::|: :.:..|.  |:|||..:|..|.||
Zfish   294 LVMLKKY--SNYTDP-PASVVDAFAAGIRPSFSNFVQYLL-DPSTEKEMPFNEHWRQMYRLCHPC 354

  Fly   310 SVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKIGNQARSGVKSEALVERYFADL 374
            .:|:..:||.||...|:|.::|...:::::    :.|:..:    |:..|..:.:     :||::
Zfish   355 QINYDFVGKLETLDEDAEHLLRILRVDNIV----EFPESHR----NRTVSSWEQD-----WFANI 406

  Fly   375 DRSTLDQLLKIYRIDFELFDY 395
            ...|..:|.::|..||:||.|
Zfish   407 PLETRKELYRLYEADFKLFGY 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 73/265 (28%)
chst12aNP_998712.2 Sulfotransfer_2 182..427 CDD:281554 73/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.