DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and chst11

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_997989.2 Gene:chst11 / 404232 ZFINID:ZDB-GENE-040315-1 Length:352 Species:Danio rerio


Alignment Length:307 Identity:85/307 - (27%)
Similarity:147/307 - (47%) Gaps:43/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 EELHSRTEREL-------QRRSEHLAAVCDRYKLQEK----YPPNPWEFFVSPGHNNLVWCNVFK 171
            :||::.|:.|.       |.|.:.:|..|..:....:    ..|:..:..|....:.|::|.|.|
Zfish    61 QELYNPTQAEFSAAAVLHQARRDQVAETCHAHSASSRKRRVLTPSDLKHLVVDEDHELIYCYVPK 125

  Fly   172 AASSTWMYYFNILAGYDVKYLQRTETQPLELAR---------KRFPRPELGELMELLPSALSFLF 227
            .|.:.|.....:|:|.. ||     :.|:|:..         |...:..:.::...|.:.|.|||
Zfish   126 VACTNWKRVMMVLSGRG-KY-----SNPMEIPSNEAHVPSNLKTLNQYSIPDINHRLKNYLKFLF 184

  Fly   228 VRDPFERILSAYRNKLEGNKNT-FYKALGNKIVHRYRKRNLGGPWPRCGP--TFEEFVRFLIAEH 289
            ||:||||::||||||.....|| |:|..|.|||.|||| |......:.|.  .|:||..:|:...
Zfish   185 VREPFERLVSAYRNKFTLRYNTSFHKRYGTKIVRRYRK-NATTEALQSGADVKFQEFAEYLVDPG 248

  Fly   290 AAGKR-FDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKI 353
            ...:. .:|||..|||.|.||.:::.::||.||.:.|:.::::       |:|.|     ...:.
Zfish   249 TQREAPLNEHWQTVYSLCHPCHIHYDLVGKYETLEDDANYVLK-------LVGEG-----DSLRF 301

  Fly   354 GNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDYDYRRY 400
            .:.|:|...::.:...:|.::......||.::|::|:.:|:|....|
Zfish   302 PSFAKSTRTTDQMAAMFFGNISSQQQSQLYQLYKLDYLMFNYSIPSY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 73/247 (30%)
chst11NP_997989.2 Sulfotransfer_2 113..343 CDD:281554 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.