DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and Y87G2A.16

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001021832.1 Gene:Y87G2A.16 / 3565642 WormBaseID:WBGene00013602 Length:356 Species:Caenorhabditis elegans


Alignment Length:365 Identity:80/365 - (21%)
Similarity:125/365 - (34%) Gaps:110/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SSSSQAAAPPPPP------------PATTLNPVYEYSEELHSRTERELQRRSEHLAAVCDRYKLQ 145
            :::|....||..|            ....||.:    |.|......:|..|:.:|:||....||:
 Worm    35 NATSSTIKPPKTPKFYKILNWEKRESEKRLNNI----EALIRANSNKLPNRTSNLSAVQLCSKLR 95

  Fly   146 EKYPPN----PWEFFVSPGHNNLVWCNVFKAASSTWMYYFNILAG------------YDVKYLQ- 193
            ....|.    ..|...||.: ||..|.|.|:.|:.....|..|..            .|.|.:: 
 Worm    96 SPCLPALKDFEGEIRTSPRY-NLSTCVVQKSMSTVMTSMFCYLRDEKKFVGNHRELLKDWKIVRF 159

  Fly   194 ---RTETQPLELARKRF---PRPELGELMELLPSALSFLFVRDPFERILSAYRNKLEGNKNTFYK 252
               :.|.:.|....|:|   |.|.         :....:.||.||||.:|.:.:|.       |:
 Worm   160 CMFKNEFRNLGGVFKKFKIPPAPN---------NWTHIMMVRHPFERFVSGFVDKC-------YR 208

  Fly   253 ALGNKIVHRYRK---RNLGGPWPRCGPTFEEFVRFLIAEHAAGKRF-----DEHWAPVYSFCT-- 307
               ..::.:|..   |||     .|   |.|.....:.:.....:|     |.|:.|....|.  
 Worm   209 ---KPVIQKYCNGCGRNL-----TC---FMETELKRMGQQVESGKFQRTYEDRHFFPQSWRCNLH 262

  Fly   308 PCSVNFTII--GKTETFQRDSEFI-------IRQAGLESLLLGLGKLPQRKQRKIGNQARSGVKS 363
            ....|||.|  ..:..|...|:..       :.|:.|:.:...|         ..|..|.|.|.|
 Worm   263 QYFSNFTFILYSSSHNFSITSQLFPIFRQHSVPQSSLDFIETSL---------SAGRTAHSTVDS 318

  Fly   364 EA--LVER------YFADLDRSTLDQLLKIYRIDFELFDY 395
            :|  .:|:      |..:|       |:|::..||.||::
 Worm   319 KATSFIEKRLNSSPYLMEL-------LVKMFYHDFVLFNF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 61/280 (22%)
Y87G2A.16NP_001021832.1 Sulfotransfer_2 112..351 CDD:281554 63/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.