DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and Chst8

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001100974.1 Gene:Chst8 / 308511 RGDID:1308979 Length:417 Species:Rattus norvegicus


Alignment Length:371 Identity:97/371 - (26%)
Similarity:162/371 - (43%) Gaps:65/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ELEAESEPSK------QQLKLKRQQLQRQRILAKQQEQGKGIAGGNASAGSSSSQAAAPPPPPPA 107
            :|:|..:|..      ..|:|::   :|:|:|.|:      :.......|::||:....|.|   
  Rat    80 QLQAPDQPGSHPKAAGSPLRLRQ---RRRRLLIKK------MPAAGTMRGNNSSETFIQPRP--- 132

  Fly   108 TTLNPVYEYSEELHSRTERELQRRSEHLAAVCDRYKLQEK----YPPNPWEFFVSPGHNNLVWCN 168
               ..|......|| :|::|   |...:...|.:|:....    .|.:....||...| .:::|.
  Rat   133 ---RTVDSRWLSLH-QTQQE---RKRVMQEACAKYRASSSRRAVTPRHVSRIFVEDRH-RVLYCE 189

  Fly   169 VFKAASSTWMYYFNILAGY-----DVKYLQRTETQPLELARKRFPRPELGELMELLPSALSFLFV 228
            |.||..|.|.....:|||.     |:::    .|.....|.||....:...::..|.:....|||
  Rat   190 VPKAGCSNWKRVLMVLAGLASSTADIQH----NTVHYGSALKRLDTFDRQGIVHRLSTYTKMLFV 250

  Fly   229 RDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKR------NLGGPWPRCGPTFEEFVRFLIA 287
            |:||||::||:|:|.|...:.::...|..|:.|||..      ..|.     |..|.|||::|:.
  Rat   251 REPFERLVSAFRDKFEHPNSYYHPVFGKAILARYRANASREALRTGS-----GVQFPEFVQYLLD 310

  Fly   288 EH-AAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKL--PQRK 349
            .| ..|  .|.||..|...|:||.:::..:||.|:.:.|:.|.:|      |:...|.|  |:.|
  Rat   311 VHRPVG--MDIHWDHVSRLCSPCLIDYDFVGKFESMEDDANFFLR------LIHAPGNLTFPRFK 367

  Fly   350 QRKIGNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFELFDY 395
            .|. ..:||:   :..:..:|||.|......:....|.:|:.:|:|
  Rat   368 DRH-SEEART---TSRITHQYFAQLSSLQRQRTYDFYYMDYLMFNY 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 71/248 (29%)
Chst8NP_001100974.1 Sulfotransfer_2 180..409 CDD:281554 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.