DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and T15D6.1

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_493132.1 Gene:T15D6.1 / 188530 WormBaseID:WBGene00011778 Length:302 Species:Caenorhabditis elegans


Alignment Length:325 Identity:67/325 - (20%)
Similarity:119/325 - (36%) Gaps:98/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PVYEYSEELHSRTEREL-----QRRSEHLAA--VCDRYKLQEKYPPNPWEFFVSPGHNNLVWCNV 169
            |...||:.|.:..|.:|     .:....|..  :|..|:.|| |..|.:                
 Worm    38 PFVNYSKMLLTAPENQLISCLIPKSMSQLTVNIMCLLYEKQE-YFKNDY---------------- 85

  Fly   170 FKAASSTWMYYFNILAGYDVKYLQRTETQPLELARKRFPRPELGELMELLPSALSFLFVRDPFER 234
              :.:.||....|.|.  :.|::     .|||..:|               ..:.|.|:|||.:|
 Worm    86 --SLNDTWTSQRNCLE--EFKFI-----HPLEPIQK---------------GTVKFAFIRDPLKR 126

  Fly   235 ILSAYRNKLEGNKN-----TFYKALGNKIVHRYRKRNLGGPWPRCGPTFEEFVRFLIAEHAAGKR 294
            .:|.|.:|....|:     |..:.:..|:....:|  :...|.  |.:...:|.    :|||...
 Worm   127 FVSFYLDKCVREKHCYDCGTNMRCVVEKVYTNLKK--IQNSWH--GTSELGYVE----QHAAPMS 183

  Fly   295 FD-------EHW--APVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQ 350
            ::       |.|  .|:.|....         :|...:|.|..:.:|...::|:..:     ::.
 Worm   184 WNCNFHKDIESWELIPIGSDANE---------RTIAIERLSGLLKKQGVNQTLIEKV-----QEG 234

  Fly   351 RKIGNQARSGVKSEALVERYFAD--LDRSTLDQLLKIYRIDFELFDY--DYR------RYYDMVH 405
            ||.|....|...|.|   |:.|:  :.:....|.| ||..|:.:|.:  |::      :|:.:.|
 Worm   235 RKSGETEHSTHASNA---RFEAERIIQKDPYIQNL-IYFFDYLVFPFTKDFKIPFTTTQYHRINH 295

  Fly   406  405
             Worm   296  295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 51/250 (20%)
T15D6.1NP_493132.1 Sulfotransfer_2 49..277 CDD:281554 60/294 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.