DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and K07H8.8

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_501387.2 Gene:K07H8.8 / 187128 WormBaseID:WBGene00019508 Length:318 Species:Caenorhabditis elegans


Alignment Length:358 Identity:68/358 - (18%)
Similarity:118/358 - (32%) Gaps:112/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PPATTLNPVYEYSEELHSRTERELQRR---SEHLAAVC---DRYKLQEKYPPNPWEFFVSPGHNN 163
            |..||.|..|      :.:.||.:.:.   ...:.::|   |:|::..|...:.....|....||
 Worm     4 PYCTTSNKFY------YGKKERYIPKAVLVVMGIFSICFSIDKYQILMKEIESKECNDVLAECNN 62

  Fly   164 LVWCNVFKAASSTWMYYFNILAGYDVK-----------------YLQRTE-------TQPLELAR 204
            :.:...|......::..|.|...||:.                 |:|..|       |...|:..
 Worm    63 IPFNQTFVPPFYDYLQDFTISPRYDISLCLIPKVVSTIGTAAICYIQDPEAFTKNNRTISTEMYG 127

  Fly   205 KRFPRPELGELMELLPSAL-----SFLFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRK 264
            .||......:..:::..:|     :.:|.|:|::|.:|.:..|...|.:|       .|.|    
 Worm   128 GRFCENNELKSFKMVQRSLNSNFDNIIFTRNPYDRFISGFTEKCVNNTDT-------NICH---- 181

  Fly   265 RNLGGPWPRCGPTFEEFVR----------FLIAEHAAGKRFDEHWAPVYSFCTPCS--VNFTIIG 317
                    .||.....|::          .|...:...   |.|:||...:|...:  .|.|:|.
 Worm   182 --------GCGTDIRCFLQKEYRRLIRMSMLFPVYTGA---DTHFAPQTWYCDMKNNIKNSTVIQ 235

  Fly   318 KTETFQRDSEFIIRQAGLESL-----LLGLGK---LPQRKQRKIGNQARSG------------VK 362
            .:.|            |.|.:     ||.:.|   :|:....::..:...|            :|
 Worm   236 YSST------------GTEKIKMIDNLLTVFKNRNVPEENLNEVREELSKGKTQHSTSGTSLRLK 288

  Fly   363 SEALVERYFADLDRSTLDQLLKIYRIDFELFDY 395
            .|.|:|.     |.:....|.:||..||....|
 Worm   289 YEKLIEE-----DGAIRRALQRIYYYDFLYLGY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 55/295 (19%)
K07H8.8NP_501387.2 Sulfotransfer_2 83..316 CDD:335378 50/271 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.