DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and F56H6.13

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001361878.1 Gene:F56H6.13 / 186423 WormBaseID:WBGene00010173 Length:314 Species:Caenorhabditis elegans


Alignment Length:301 Identity:69/301 - (22%)
Similarity:104/301 - (34%) Gaps:96/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YPPNPWEFFVSPGHNNLVWCNVFKAASSTWMYYFNILAGYDVKYL--QRTETQPLELARKRFPRP 210
            |.|.   ||||| .|.||.|.:.|:.|........:|.. :.:::  :.|.....|..|......
 Worm    50 YVPG---FFVSP-ENKLVACEIRKSMSQLTTNLMCLLYN-ETQFVADKNTLNDTWEAPRHCMQEH 109

  Fly   211 ELGELMELLPS---ALSFLFVRDPFERILSAYRNKLEGNKNTFY----------KALGNKIVHRY 262
            ......:.|.:   .:.|.|:|||..|.||.|.||.. :|:..|          :.:.|.:.:..
 Worm   110 SFTNFSDDLKNDTDTVKFAFIRDPIRRFLSFYLNKCV-DKSECYDCGSDMRCVVERIYNGLWNIQ 173

  Fly   263 RKRNLGGPWPRCGPTFEEFVRFLIAEHAAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSE 327
            ..||:         ||     .|:..|||...::            |..| ..:.|.|.....|:
 Worm   174 NDRNM---------TF-----ILMEAHAAPLSWN------------CGFN-EGVSKWELLMMGSD 211

  Fly   328 F------------IIRQAGLESLLLGLGKLPQRKQRKI--GNQARSGVKS-----------EALV 367
            .            |:|:.|:..      :|.:..::.|  |..|.|..||           |..|
 Worm   212 LDERTSSTTKLAKILRKQGVRH------ELVESIEKDILKGETAHSTFKSTNRLAAEKQIREDPV 270

  Fly   368 ERYFADLDRSTLDQLLKIYRIDFELF-------DYDYRRYY 401
            .|||          |.|||..|:.:|       |.:||..:
 Worm   271 VRYF----------LHKIYFFDYVVFPFKRDVLDPEYRSIF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 59/281 (21%)
F56H6.13NP_001361878.1 Sulfotransfer_2 57..288 CDD:367564 61/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.