DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and F56H6.4

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_493105.1 Gene:F56H6.4 / 186415 WormBaseID:WBGene00010165 Length:316 Species:Caenorhabditis elegans


Alignment Length:302 Identity:68/302 - (22%)
Similarity:98/302 - (32%) Gaps:124/302 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 FFVSPGHNNLVWCNVFKAAS-----------STWMYYFNILA-----------GYDVKYLQRTET 197
            |.|:| ...|:.|.:.|:.|           ....|:.|..:           .:|..||..:||
 Worm    61 FMVAP-DKKLISCTLRKSMSQLAENIMCLLYDEQQYFANSQSLNDTWKDERKCEHDRSYLNPSET 124

  Fly   198 QPLELARKRFPRPELGELMELL--PSALSFLFVRDPFERILSAYRNKLE--------GNKNT--- 249
                                ||  ...:.|.|:||||:|.:|.|.:|..        ||..|   
 Worm   125 --------------------LLNDTDTVRFAFIRDPFQRFISFYLDKCVREQKCYNCGNNMTCVL 169

  Fly   250 --FYKALGNKIVHRYRKRNLGGPWPRCGPTFEEFVRFLIAEHAAGKRFDEHWAPVYSFCTPCSVN 312
              ||..| .|:..|:..|.        .|.:.|.       |||                |.|.|
 Worm   170 KNFYWGL-KKVQRRWDGRE--------QPEYVEI-------HAA----------------PLSWN 202

  Fly   313 ---FTIIGKTETFQRDSEFIIRQAGL---ESLLLGLGKLPQRKQR-------------KIGNQAR 358
               :..:.|.:.....|:...|.:.:   |.:|        ||||             |.|:...
 Worm   203 CDFYKDLSKWQLIPIGSDKTERSSAITQTEKIL--------RKQRVNETLVDMVVDGMKDGDTDH 259

  Fly   359 SGVKS----EALVERYFADLDRSTLDQLLKIYRIDFELFDYD 396
            |..||    ||  ||...: |....:.|.|||..|:.:|.::
 Worm   260 STYKSAHRLEA--ERQIRE-DPYIREMLHKIYYFDYVVFPFN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 65/294 (22%)
F56H6.4NP_493105.1 Sulfotransfer_2 64..297 CDD:281554 66/296 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.