DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and F55B12.2

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_506420.3 Gene:F55B12.2 / 186281 WormBaseID:WBGene00010088 Length:327 Species:Caenorhabditis elegans


Alignment Length:282 Identity:59/282 - (20%)
Similarity:98/282 - (34%) Gaps:89/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 HNNLVWCNVFKAASSTWMYYFNILAGYDVKYLQRTETQPLELARKRFPRPELGELMELLPSALSF 225
            ||...:.|..::.:.|||.. .:.:..|.::              ..|:..:.:...|    ..|
 Worm   100 HNETEFQNQNRSLNDTWMSE-RVCSHKDPEF--------------HIPQKNVEQYQNL----TKF 145

  Fly   226 LFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKRNLGGPWPRCGPTFEEFVRFLI---- 286
            .|:||||:|.:|.|                   :|..:..|  |.|. ||......||.:.    
 Worm   146 AFIRDPFDRFISFY-------------------LHVCKNDN--GCWD-CGDNMRCVVRNVYKSLK 188

  Fly   287 -----AEHAAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQR------DSEFIIRQAGLESL-- 338
                 .:.|:....|.|.||:...|     ||     .|||.:      ..::..|.|.:..|  
 Worm   189 SYENDPDEASSSSIDRHAAPITWNC-----NF-----QETFSQYHLIKIGFDYQSRHAAITQLTD 243

  Fly   339 LLGLGKLPQRKQRKIGNQARSG------------VKSEALVERYFADLDRSTLDQLLKIYRIDFE 391
            :|...::......||.|::.:|            |::|..|..     |....:.|.|||..|:.
 Worm   244 ILYTNRVSDTLITKISNESMTGETLHGTHKSVGRVQAEQQVNE-----DSVVREYLHKIYFFDYL 303

  Fly   392 LFDYDYR----RYYDMVHPWSL 409
            :|::|..    .|..::..|.|
 Worm   304 IFNFDTNHLDDEYKQLLTSWKL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 55/262 (21%)
F55B12.2NP_506420.3 Sulfotransfer_2 74..307 CDD:281554 55/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.