DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and F36D1.8

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_492891.1 Gene:F36D1.8 / 185350 WormBaseID:WBGene00009467 Length:329 Species:Caenorhabditis elegans


Alignment Length:282 Identity:70/282 - (24%)
Similarity:105/282 - (37%) Gaps:86/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 FFVSPGHNNLVWCNVFKAASSTWMYYFNILAG-YDV-KYLQR---------TETQPLELARKRFP 208
            |||:| ...|:.|.:.|:.|....   ||:.. ||. :||.:         ||.:.||  ..:|.
 Worm    74 FFVAP-DKKLLGCGIPKSMSQLMS---NIMCFLYDENQYLAQHNSLNDTWTTERKCLE--EDQFL 132

  Fly   209 RPELGELMELL--PSALSFLFVRDPFERILSAYRNKLEGNKNTFYKALGNKIVHRYRKRNLGGPW 271
            .|    ..|||  |..:.|.|:|||..|.:|.|.:|....|:.:                     
 Worm   133 NP----TFELLNDPDLVRFAFIRDPIHRFISLYLDKCIYTKSCY--------------------- 172

  Fly   272 PRCGPTFEEFVRFLIAE-----------HAAGKRFDEHWAPVYSFCTPCSVNFTIIGKTETFQRD 325
             .||.....||:.:...           |.|.. .::|.||:..:|     ||     .|..::.
 Worm   173 -NCGTNMACFVQRIYETLNRIKSNRRRLHEASS-IEQHVAPLSWYC-----NF-----NENIKKY 225

  Fly   326 SEFIIRQAGLE---SLLLGLGKLPQRK------QRKIGNQARSGVKSEAL--------VERYFAD 373
            | .::..|.||   |.:|.|..:.:|:      ..||.|.|..|..:.:.        .||...:
 Worm   226 S-LLMMGADLEERRSSILHLANILKRQGFSEKTVEKIQNDALGGETAHSTHKSSHRLEAERQVRE 289

  Fly   374 LDRSTLDQLLKIYRIDFELFDY 395
             |....|.|.|||..|:.:|.:
 Worm   290 -DPVIRDLLHKIYFFDYVVFPF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 66/275 (24%)
F36D1.8NP_492891.1 Sulfotransfer_2 77..310 CDD:281554 67/277 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.