DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and ZK1025.2

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_492924.1 Gene:ZK1025.2 / 173030 WormBaseID:WBGene00014182 Length:301 Species:Caenorhabditis elegans


Alignment Length:291 Identity:70/291 - (24%)
Similarity:104/291 - (35%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YPPNPWEFFVSPGHNNLVWCNVFKAASSTWMYYFNILAGYDVKYLQ---------RTETQPLELA 203
            |.|:   ||.:| .|.|:.|.:.|:.|...:....:|.. :.:|||         .|.|:.. .:
 Worm    37 YAPS---FFTAP-DNKLIACEIRKSMSQLTLNMMCLLYN-ETQYLQDKNNFTNTWETSTRKC-TS 95

  Fly   204 RKRFPRPELGELMELLPSALSFLFVRDPFERILSAYRNKLEGNKNTF-----YKALGNKIVHRYR 263
            ...|..|  .:.::....|:.|:||||||.|.:|.|.||....|..|     .:.:..|      
 Worm    96 ETNFVTP--SDSLKNDKDAVRFVFVRDPFRRFVSMYLNKCVVEKRCFDCETDMRCIAKK------ 152

  Fly   264 KRNLGGPWPRCGPTFEEFVRFLIAE-HAAGKRFDE-HWAPVYSFCTPCSVNFTIIGKTETFQRDS 326
                         |:|.||.....| .|||..:.| |.||....|           |......:.
 Worm   153 -------------TYESFVEIQNNETKAAGIEYVEAHAAPTTWNC-----------KFNEGVENW 193

  Fly   327 EFIIRQAGLESLLLGLGKLPQ--RKQRKIGNQARSGVKSEALVERYFADL--------------- 374
            |.:...:.|:..:....||..  |||         ||: :.|||:.:.|:               
 Worm   194 ELLPMDSDLKDRISSAAKLADILRKQ---------GVR-DTLVEQIYKDILTTETAHSTHKWTKR 248

  Fly   375 ---------DRSTLDQLLKIYRIDFELFDYD 396
                     |....:.|.|||..|:.||.:|
 Worm   249 LEAEKQVREDPIVREYLHKIYLYDYLLFPFD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 64/276 (23%)
ZK1025.2NP_492924.1 Sulfotransfer_2 44..278 CDD:281554 65/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.