DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14024 and CHST13

DIOPT Version :9

Sequence 1:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_690849.1 Gene:CHST13 / 166012 HGNCID:21755 Length:341 Species:Homo sapiens


Alignment Length:334 Identity:97/334 - (29%)
Similarity:147/334 - (44%) Gaps:47/334 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AGGNASAGSS--SSQAAAPPPPPPATTLNPVYEYSEELHSRTERELQRRSEHLAAVCDRYKLQEK 147
            |.||.:.|||  ..:..:|        |..:|:..::..|...:..::|.:.|.:.|.|:..:::
Human    33 AFGNRALGSSWLGGEKRSP--------LQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQR 89

  Fly   148 --YPPNPWEFFVSPGHNNLVWCNVFKAASSTWMYYFNILAGY---DVKYLQRTETQPLELARKRF 207
              .|.:.....|...| .|::|.|.|.|.:.|......|:|.   |.:.:...|..    |..|.
Human    90 LLQPEDLRHVLVDDAH-GLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAH----APGRL 149

  Fly   208 P-----RPELGELMELLPSALSFLFVRDPFERILSAYRNKL-EGNKNTFYKALGNKIVHRYRKRN 266
            |     .|  .|:...|.:.|:|||||:||||:.||||||| ......|.:..|.:||.|.|.|.
Human   150 PSLADFSP--AEINRRLRAYLAFLFVREPFERLASAYRNKLARPYSAAFQRRYGARIVQRLRPRA 212

  Fly   267 LGGPWPRC---GPTFEEFVRFLIAEHAAGKR-FDEHWAPVYSFCTPCSVNFTIIGKTETFQRDSE 327
            |  |..|.   ...|.||:.:|:......:. |:|||...::.|.||.:.:.::||.||...|:.
Human   213 L--PDARARGHDVRFAEFLAYLLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAA 275

  Fly   328 FIIRQAGLESLLL-GLGKLPQRKQRKIGNQARSGVKSEALVERYFADLDRSTLDQLLKIYRIDFE 391
            |::..||...|.. |    |.|        .|....|..|..|.|.|:......:|..:|::||.
Human   276 FVLGLAGASDLSFPG----PPR--------PRGAAASRDLAARLFRDISPFYQRRLFDLYKMDFL 328

  Fly   392 LFDYDYRRY 400
            ||:|....|
Human   329 LFNYSAPSY 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 79/248 (32%)
CHST13NP_690849.1 Sulfotransfer_2 102..332 CDD:281554 79/250 (32%)
Cell attachment site. /evidence=ECO:0000255 132..134 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.